RegulonDB RegulonDB 10.7: Gene Form
   

ydfR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rrrQ rzpQ ydfR rzoQ essQ terminator

Gene      
Name: ydfR    Texpresso search in the literature
Synonym(s): ECK1549, G6828, b1555
Genome position(nucleotides): 1640054 <-- 1640365 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.59
External database links:  
ASAP:
ABE-0005192
ECHOBASE:
EB3591
OU-MICROARRAY:
b1555
PORTECO:
ydfR
REGULONDB:
b1555
STRING:
511145.b1555
M3D: ydfR
COLOMBOS: ydfR
PortEco: b1555


Product      
Name: Qin prophage; protein YdfR
Synonym(s): YdfR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.091
Isoelectric point: 5.639
Motif(s):
 
Type Positions Sequence
1 -> 88 MTQDYELVVKGVRNFENKVTVTVALQDKERFDGEIFDLDVAMDRVEGAALEFYEAAARRSVRQVFLEVAEKLSEKVESYLQHQYSFKI

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
DIP:
DIP-11703N
ECOCYC:
G6828-MONOMER
ECOLIWIKI:
b1555
INTERPRO:
IPR009759
PFAM:
PF07041
PRIDE:
P76160
PROTEINMODELPORTAL:
P76160
REFSEQ:
NP_416073
UNIPROT:
P76160


Operon      
Name: essQ-ydfR-rrrQ-rzpQ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056


RegulonDB