RegulonDB RegulonDB 10.7: Gene Form
   

essQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydfR essQ ynfU rrrQ terminator

Gene      
Name: essQ    Texpresso search in the literature
Synonym(s): ECK1550, G6829, b1556, ydfS
Genome position(nucleotides): 1640370 <-- 1640585 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.3
External database links:  
ASAP:
ABE-0005197
ECHOBASE:
EB3592
ECOO157CYC:
Z1468
ECOO157CYC:
Z3106
ECOO157CYC:
Z2374
ECOO157CYC:
Z2122
ECOO157CYC:
Z1350
ECOO157CYC:
Z1794
ECOO157CYC:
Z2069
OU-MICROARRAY:
b1556
PORTECO:
essQ
REGULONDB:
b1556
STRING:
511145.b1556
M3D: essQ
COLOMBOS: essQ
PortEco: b1556


Product      
Name: Qin prophage; putative prophage lysis protein EssQ
Synonym(s): EssQ, YdfS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 7.741
Isoelectric point: 10.233
Motif(s):
 
Type Positions Sequence
36 -> 58 WAAIGVLGSLVFGLLTYLTNLYF
5 -> 67 DKLTTGVAYGTSAGNAGFWALQLLDKVTPSQWAAIGVLGSLVFGLLTYLTNLYFKIKEDRRKA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005887 - integral component of plasma membrane
biological_process GO:0019835 - cytolysis
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6829-MONOMER
ECOLIWIKI:
b1556
ECOO157CYC:
Z1350-MONOMER
ECOO157CYC:
Z3106-MONOMER
ECOO157CYC:
Z2374-MONOMER
ECOO157CYC:
Z2122-MONOMER
ECOO157CYC:
Z2069-MONOMER
ECOO157CYC:
Z1794-MONOMER
ECOO157CYC:
Z1468-MONOMER
INTERPRO:
IPR007054
PFAM:
PF04971
PRIDE:
P77237
PROTEINMODELPORTAL:
P77237
REFSEQ:
NP_416074
UNIPROT:
P77237


Operon      
Name: essQ-ydfR-rrrQ-rzpQ         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB