RegulonDB RegulonDB 10.8: Gene Form
   

ydfT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydfU ydfT ynfS

Gene      
Name: ydfT    Texpresso search in the literature
Synonym(s): ECK1553, G6830, b1559, quuQ
Genome position(nucleotides): 1642489 <-- 1643241 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.94
External database links:  
ASAP:
ABE-0005207
ECHOBASE:
EB3593
OU-MICROARRAY:
b1559
PortEco:
ydfT
STRING:
511145.b1559
COLOMBOS: ydfT


Product      
Name: Qin prophage; putative antitermination protein Q
Synonym(s): QuuQ, YdfT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.926
Isoelectric point: 9.209
Motif(s):
 
Type Positions Sequence
155 -> 242 GEASTACRGCKGKGIVLDEKRTRFHGVPVYKICGRCNGNRFSRLPTTLARRHVQKLVPDLTDYQWYKGYADVIGKLVTKCWQEEAYAE
24 -> 107 TGTGCLTITDVMAAQGMVQSKAPLGLALFLAKVGVQDPQFAIEGLLNYAMALDNPTLNKLSEEIRLQIIPYLVSFAFADYSRSA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0031564 - transcription antitermination
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-28061N
ECOCYC:
G6830-MONOMER
ECOLIWIKI:
b1559
INTERPRO:
IPR003222
INTERPRO:
IPR036410
PFAM:
PF03589
PRIDE:
P76161
PRODB:
PRO_000023672
REFSEQ:
NP_416077
SMR:
P76161
UNIPROT:
P76161


Operon      
Name: ydfUT         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB