RegulonDB RegulonDB 10.8: Gene Form
   

ydfU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydfU ydfT rem

Gene      
Name: ydfU    Texpresso search in the literature
Synonym(s): ECK1554, G6831, b1560
Genome position(nucleotides): 1643255 <-- 1644304 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.19
External database links:  
ASAP:
ABE-0005209
ECHOBASE:
EB3594
OU-MICROARRAY:
b1560
PortEco:
ydfU
STRING:
511145.b1560
COLOMBOS: ydfU


Product      
Name: Qin prophage; protein YdfU
Synonym(s): YdfU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.26
Isoelectric point: 8.009
Motif(s):
 
Type Positions Sequence
131 -> 346 ESLELLAQQNLTAWVIDVIRHAISGTQERELSLAELSWWAVCNQVVDALPEAVSRRSLGLPAEKICSVYRESDIVPGELTATSILKQRTKNLAPLPYAHQQQKSPQEKTVVSITVDPESPESFMKLPKRRRWVKEKYTRWVKTQPCACCGMPADDPHHLIGHGQGGMGTKAHDLFVLPLCRKHHNELHTDTVAFEDKYGSQLELIFRFIDRALAIG

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
DIP:
DIP-48000N
ECOCYC:
G6831-MONOMER
ECOLIWIKI:
b1560
INTERPRO:
IPR003615
INTERPRO:
IPR010373
PFAM:
PF06147
PRIDE:
P76162
REFSEQ:
NP_416078
SMART:
SM00507
UNIPROT:
P76162


Operon      
Name: ydfUT         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056


RegulonDB