RegulonDB RegulonDB 10.7: Gene Form
   

flxA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

flxA ydfV ydfW Fis RelB-RelE RelB-RelE RelB flxAp flxAp TSS_1866 TSS_1866 relBp relBp TSS_1865 TSS_1865

Gene      
Name: flxA    Texpresso search in the literature
Synonym(s): ECK1560, G6833, b1566
Genome position(nucleotides): 1646405 --> 1646737 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.94
External database links:  
ASAP:
ABE-0005234
ECHOBASE:
EB3203
OU-MICROARRAY:
b1566
PORTECO:
flxA
REGULONDB:
b1566
STRING:
511145.b1566
M3D: flxA
COLOMBOS: flxA
PortEco: b1566


Product      
Name: Qin prophage; protein FlxA
Synonym(s): FlxA
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 12.208
Isoelectric point: 4.724
Motif(s):
 
Type Positions Sequence
10 -> 101 STVISNNSAPEGTSEIAKITRQIQVLTEKLGKISSEEGMTTQQKKEMAALVQKQIESLWAQLEQLLRQQAEKKNEDATVQPDKKEEKKDDTN

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9667N
ECOCYC:
G6833-MONOMER
ECOLIWIKI:
b1566
INTERPRO:
IPR025577
MINT:
MINT-1263166
PFAM:
PF14282
PRIDE:
P77609
PRODB:
PRO_000022674
PROTEINMODELPORTAL:
P77609
REFSEQ:
NP_416084
UNIPROT:
P77609


Operon      
Name: flxA         
Operon arrangement:
Transcription unit        Promoter
flxA


Transcriptional Regulation      
Display Regulation             
Activated by: Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1865 1645901 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1866 1646073 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB