RegulonDB RegulonDB 10.7: Gene Form
   

rspB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rspA rspB ynfP

Gene      
Name: rspB    Texpresso search in the literature
Synonym(s): ECK1575, G6838, b1580
Genome position(nucleotides): 1652896 <-- 1653915 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.9
External database links:  
ASAP:
ABE-0005272
ECHOBASE:
EB2346
OU-MICROARRAY:
b1580
PORTECO:
rspB
REGULONDB:
b1580
STRING:
511145.b1580
M3D: rspB
COLOMBOS: rspB
PortEco: b1580


Product      
Name: putative zinc-binding dehydrogenase RspB
Synonym(s): RspB, putative oxidoreductase, Zn-dependent and NAD(P)-binding
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.564
Isoelectric point: 6.351
Motif(s):
 
Type Positions Sequence
171 -> 297 PIGLTIVQVLKGVYNVKNVIVADRIDERLEKAKESGADWAINNSQTPLGEIFTEKGIKPTLIIDAACHPSILKEAVTLASPAARIVLMGFSSEPSEVIQQGITGKELSIFSSRLNANKFPIVIDWLS
25 -> 131 GEVRVKVKLAGICGSDSHIYRGHNPFAKYPRVIGHEFFGVIDAVGEGVESARVGERVAVDPVVSCGHCYPCSIGKPNVCTTLAVLGVHADGGFSEYAVVPAKNAWKI

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.3 - starvation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0008270 - zinc ion binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6838-MONOMER
ECOLIWIKI:
b1580
INTERPRO:
IPR013149
INTERPRO:
IPR036291
INTERPRO:
IPR013154
INTERPRO:
IPR011032
INTERPRO:
IPR002328
MODBASE:
P38105
PANTHER:
PTHR11695
PFAM:
PF00107
PFAM:
PF08240
PRIDE:
P38105
PROSITE:
PS00059
PROTEINMODELPORTAL:
P38105
REFSEQ:
NP_416097
SMR:
P38105
UNIPROT:
P38105


Operon      
Name: rspAB         
Operon arrangement:
Transcription unit        Promoter
rspA-rspB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB