RegulonDB RegulonDB 10.7: Gene Form
   

rspA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rspA rspB ynfA GadX

Gene      
Name: rspA    Texpresso search in the literature
Synonym(s): ECK1576, G6839, b1581
Genome position(nucleotides): 1653927 <-- 1655141 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.7
External database links:  
ASAP:
ABE-0005275
ECHOBASE:
EB2345
OU-MICROARRAY:
b1581
PORTECO:
rspA
REGULONDB:
b1581
STRING:
511145.b1581
M3D: rspA
COLOMBOS: rspA
PortEco: b1581


Product      
Name: mandelate racemase/muconate lactonizing enzyme family protein RspA
Synonym(s): RspA, starvation-sensing protein RspA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 45.968
Isoelectric point: 5.982
Motif(s):
 
Type Positions Sequence
13 -> 110 PGRNFVTLKITTEDGITGLGDATLNGRELSVASYLQDHLCPQLIGRDAHRIEDIWQFFYKGAYWRRGPVTMSAISAVDMALWDIKAKAANMPLYQLLG
195 -> 379 LFDAVRNKFGFNEHLLHDMHHRLTPIEAARFGKSIEDYRMFWMEDPTPAENQECFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRTTLTHAGGITGMRRIADFASLYQVRTGSHGPSDLSPVCMAAALHFDLWVPNFGVQEYMGYSEQMLEVFPHNWTFDNGYMHPGDKPGLGIEFDEK

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.3 - starvation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0009063 - cellular amino acid catabolic process
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
[NAS] Non-traceable author statement
Reference(s): [1] Gerlt JA., et al., 2005
[2] Huisman GW., et al., 1994
External database links:  
DIP:
DIP-10805N
ECOCYC:
G6839-MONOMER
ECOLIWIKI:
b1581
INTERPRO:
IPR036849
INTERPRO:
IPR013341
INTERPRO:
IPR034593
INTERPRO:
IPR013342
INTERPRO:
IPR018110
INTERPRO:
IPR029017
INTERPRO:
IPR029065
INTERPRO:
IPR034589
MODBASE:
P38104
PANTHER:
PTHR43287:SF3
PANTHER:
PTHR43287
PFAM:
PF02746
PFAM:
PF13378
PRIDE:
P38104
PRODB:
PRO_000023888
PROSITE:
PS00909
PROSITE:
PS00908
PROTEINMODELPORTAL:
P38104
REFSEQ:
NP_416098
SMART:
SM00922
SMR:
P38104
UNIPROT:
P38104


Operon      
Name: rspAB         
Operon arrangement:
Transcription unit        Promoter
rspA-rspB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Gerlt JA., Babbitt PC., Rayment I., 2005, Divergent evolution in the enolase superfamily: the interplay of mechanism and specificity., Arch Biochem Biophys 433(1):59-70

 [2] Huisman GW., Kolter R., 1994, Sensing starvation: a homoserine lactone--dependent signaling pathway in Escherichia coli., Science 265(5171):537-9


RegulonDB