RegulonDB RegulonDB 10.8: Gene Form
   

ynfA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rspA ynfB ynfA GadX TSS_1871 TSS_1871 TSS_1870 TSS_1870 ynfBp ynfBp ynfAp4 ynfAp4 ynfAp5 ynfAp5 ynfAp7 ynfAp7

Gene      
Name: ynfA    Texpresso search in the literature
Synonym(s): ECK1577, G6840, b1582
Genome position(nucleotides): 1655347 <-- 1655673 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.68
External database links:  
ASAP:
ABE-0005279
ECHOBASE:
EB3600
OU-MICROARRAY:
b1582
PortEco:
ynfA
STRING:
511145.b1582
COLOMBOS: ynfA


Product      
Name: putative transporter YnfA
Synonym(s): YnfA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 11.919
Isoelectric point: 8.975
Motif(s):
 
Type Positions Sequence
31 -> 51 SIWLLLPAGISLALFVWLLTL
61 -> 81 AAYGGVYVCTALMWLRVVDGV
85 -> 105 LYDWTGALIALCGMLIIVAGW
6 -> 26 LLFFATALCEIIGCFLPWLWL
1 -> 107 MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVYAAYGGVYVCTALMWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
G6840-MONOMER
ECOLIWIKI:
b1582
INTERPRO:
IPR003844
PANTHER:
PTHR36116
PFAM:
PF02694
PRIDE:
P76169
REFSEQ:
NP_416099
UNIPROT:
P76169


Operon      
Name: ynfA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ynfAp7 1655679 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ynfAp5 1655690 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ynfAp4 1655699 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1870 1656041 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1871 1656100 forward nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB