RegulonDB RegulonDB 10.8: Gene Form
   

speG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ynfC speG ynfB ynfDp6 ynfDp6 TSS_1871 TSS_1871 TSS_1870 TSS_1870

Gene      
Name: speG    Texpresso search in the literature
Synonym(s): ECK1579, G6842, b1584
Genome position(nucleotides): 1656184 --> 1656744 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.88
External database links:  
ASAP:
ABE-0005286
ECHOBASE:
EB2341
OU-MICROARRAY:
b1584
PortEco:
speG
STRING:
511145.b1584
COLOMBOS: speG


Product      
Name: spermidine N-acetyltransferase
Synonym(s): SpeG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.887
Isoelectric point: 6.678
Motif(s):
 
Type Positions Sequence
85 -> 87 EFQ
2 -> 186 PSAHSVKLRPLEREDLRYVHQLDNNASVMRYWFEEPYEAFVELSDLYDKHIHDQSERRFVVECDGEKAGLVELVEINHVHRRAEFQIIISPEYQGKGLATRAAKLAMDYGFTVLNLYKLYLIVDKENEKAIHIYRKLGFSVEGELMHEFFINGQYRNAIRMCIFQHQYLAEHKTPGQTLLKPTAQ
7 -> 167 VKLRPLEREDLRYVHQLDNNASVMRYWFEEPYEAFVELSDLYDKHIHDQSERRFVVECDGEKAGLVELVEINHVHRRAEFQIIISPEYQGKGLATRAAKLAMDYGFTVLNLYKLYLIVDKENEKAIHIYRKLGFSVEGELMHEFFINGQYRNAIRMCIFQH
8 -> 140 KLRPLEREDLRYVHQLDNNASVMRYWFEEPYEAFVELSDLYDKHIHDQSERRFVVECDGEKAGLVELVEINHVHRRAEFQIIISPEYQGKGLATRAAKLAMDYGFTVLNLYKLYLIVDKENEKAIHIYRKLGF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.14 - polyamine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0032991 - protein-containing complex
molecular_function GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0008080 - N-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0004145 - diamine N-acetyltransferase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
biological_process GO:0006598 - polyamine catabolic process
External database links:  
ECOCYC:
SPERMACTRAN-MONOMER
ECOLIWIKI:
b1584
INTERPRO:
IPR000182
INTERPRO:
IPR016181
MODBASE:
P0A951
PDB:
6CY6
PDB:
4R9M
PFAM:
PF13302
PRIDE:
P0A951
PRODB:
PRO_000023976
PROSITE:
PS51186
REFSEQ:
NP_416101
SMR:
P0A951
UNIPROT:
P0A951


Operon      
Name: ynfB-speG         
Operon arrangement:
Transcription unit        Promoter
ynfB-speG


Transcriptional Regulation      
Display Regulation             
Repressed by: GadX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1870 1656041 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1871 1656100 forward nd [RS-EPT-CBR] [1]
  promoter ynfDp6 1657414 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB