RegulonDB RegulonDB 10.7: Gene Form
   

ynfE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ynfE ynfF ynfD NarL NarL FNR TSS_1874 TSS_1874 ynfEp ynfEp

Gene      
Name: ynfE    Texpresso search in the literature
Synonym(s): ECK1582, G6845, b1587
Genome position(nucleotides): 1658069 --> 1660495 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.76
External database links:  
ASAP:
ABE-0005302
ECHOBASE:
EB3604
OU-MICROARRAY:
b1587
PORTECO:
ynfE
REGULONDB:
b1587
STRING:
511145.b1587
M3D: ynfE
COLOMBOS: ynfE
PortEco: b1587


Product      
Name: putative selenate reductase YnfE
Synonym(s): YnfE
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 89.78
Isoelectric point: 8.463
Motif(s):
 
Type Positions Sequence
49 -> 108 EKVVWGACSVNCGSRCALRLHVKDNEVTWVETDNTGSDEYGNHQVRACLRGRSIRRRINH
1 -> 43 MSKNERMVGISRRTLVKSTAIGSLALAAGGFSLPFTLRNAAAA
111 -> 566 RLNYPMKRVGKRGEGKFERISWDEALDTIASSLKKTVEQYGNEAVYIQYSSGIVGGNMTRSSPSASAVKRLMNCYGGSLNQYGSYSTAQISCAMPYTYGSNDGNSTTDIENSKLVVMFGNNPAETRMSGGGITYLLEKAREKSNAKMIVIDPRYTDTAAGREDEWLPIRPGTDAALVAGIAWVLINENLVDQPFLDKYCVGYDEKTLPADAPKNGHYKAYILGEGDDKTAKTPQWASQITGIPEDRIIKLAREIGTAKPAYICQGWGPQRQANGELTARAIAMLPILTGNVGISGGNSGARESTYTITIERLPVLDNPVKTSISCFSWTDAIDHGPQMTAIRDGVRGKDKLDVPIKFIWNYAGNTLVNQHSDINKTHEILQDESKCEMIVVIENFMTSSAKYADILLPDLMTVEQEDIIPNDYAGNMGYLIFLQPVTSEKFERKPIYWILSEVAKR
687 -> 800 LQLFGFHYKSRTHSTYGNIDLLKAACRQEVWINPIDAQKRGIANGDMVRVFNHRGEVRLPAKVTPRILPGVSAMGQGAWHEANMSGDKIDHGGCVNTLTTLRPSPLAKGNPQHT
44 -> 808 VQQAREKVVWGACSVNCGSRCALRLHVKDNEVTWVETDNTGSDEYGNHQVRACLRGRSIRRRINHPDRLNYPMKRVGKRGEGKFERISWDEALDTIASSLKKTVEQYGNEAVYIQYSSGIVGGNMTRSSPSASAVKRLMNCYGGSLNQYGSYSTAQISCAMPYTYGSNDGNSTTDIENSKLVVMFGNNPAETRMSGGGITYLLEKAREKSNAKMIVIDPRYTDTAAGREDEWLPIRPGTDAALVAGIAWVLINENLVDQPFLDKYCVGYDEKTLPADAPKNGHYKAYILGEGDDKTAKTPQWASQITGIPEDRIIKLAREIGTAKPAYICQGWGPQRQANGELTARAIAMLPILTGNVGISGGNSGARESTYTITIERLPVLDNPVKTSISCFSWTDAIDHGPQMTAIRDGVRGKDKLDVPIKFIWNYAGNTLVNQHSDINKTHEILQDESKCEMIVVIENFMTSSAKYADILLPDLMTVEQEDIIPNDYAGNMGYLIFLQPVTSEKFERKPIYWILSEVAKRLGPDVYQKFTEGRTQEQWLQHLYAKMLAKDPALPSYDELKKMGIYKRKDPNGHFVAYKAFRDDPEANPLKTPSGKIEIYSSRLAEIARTWELEKDEVISPLPVYASTFEGWNSPERRTFPLQLFGFHYKSRTHSTYGNIDLLKAACRQEVWINPIDAQKRGIANGDMVRVFNHRGEVRLPAKVTPRILPGVSAMGQGAWHEANMSGDKIDHGGCVNTLTTLRPSPLAKGNPQHTNLVEIEKI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0009389 - dimethyl sulfoxide reductase activity
GO:0030151 - molybdenum ion binding
GO:0033797 - selenate reductase activity
GO:0043546 - molybdopterin cofactor binding
biological_process GO:0009061 - anaerobic respiration
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Lubitz SP., et al., 2003
External database links:  
DIP:
DIP-12765N
ECOCYC:
G6845-MONOMER
ECOLIWIKI:
b1587
INTERPRO:
IPR006963
INTERPRO:
IPR009010
INTERPRO:
IPR011888
INTERPRO:
IPR006657
INTERPRO:
IPR006655
INTERPRO:
IPR006311
INTERPRO:
IPR006656
MODBASE:
P77374
PFAM:
PF04879
PFAM:
PF01568
PFAM:
PF00384
PRIDE:
P77374
PROSITE:
PS51669
PROSITE:
PS51318
PROSITE:
PS00932
PROTEINMODELPORTAL:
P77374
REFSEQ:
NP_416104
SMART:
SM00926
SMR:
P77374
UNIPROT:
P77374


Operon      
Name: ynfEFGH-dmsD         
Operon arrangement:
Transcription unit        Promoter
ynfEFGH-dmsD


Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1874 1660512 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Lubitz SP., Weiner JH., 2003, The Escherichia coli ynfEFGHI operon encodes polypeptides which are paralogues of dimethyl sulfoxide reductase (DmsABC)., Arch Biochem Biophys 418(2):205-16

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB