RegulonDB RegulonDB 10.7: Gene Form
   

ynfG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ynfF ynfH ynfG TSS_1875 TSS_1875

Gene      
Name: ynfG    Texpresso search in the literature
Synonym(s): ECK1584, G6847, b1589
Genome position(nucleotides): 1662990 --> 1663607 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.91
External database links:  
ASAP:
ABE-0005309
ECHOBASE:
EB3606
OU-MICROARRAY:
b1589
PORTECO:
ynfG
REGULONDB:
b1589
STRING:
511145.b1589
M3D: ynfG
COLOMBOS: ynfG
PortEco: b1589


Product      
Name: putative oxidoreductase YnfG
Synonym(s): YnfG
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 22.752
Isoelectric point: 6.135
Motif(s):
 
Type Positions Sequence
12 -> 25 SRCTGCKTCELACK
2 -> 205 TTQYGFFIDSSRCTGCKTCELACKDFKDLGPEVSFRRIYEYAGGDWQEDNGVWHQNVFAYYLSISCNHCDDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNAEKGHMTKCDGCYSRVAEGKQPICVESCPLRALEFGPIEELRQKHGTLAAVAPLPRAHFTKPNIVIKPNANSRPTGDTTGYLANPEEV
5 -> 33 YGFFIDSSRCTGCKTCELACKDFKDLGPE
59 -> 89 FAYYLSISCNHCDDPACTKVCPSGAMHKRED
90 -> 119 GFVVVDEDVCIGCRYCHMACPYGAPQYNAE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds
Gene Ontology Terms (GO)  
molecular_function GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48224N
ECOCYC:
G6847-MONOMER
ECOLIWIKI:
b1589
INTERPRO:
IPR017896
INTERPRO:
IPR014297
INTERPRO:
IPR017900
MODBASE:
P0AAJ1
PFAM:
PF13247
PFAM:
PF12800
PRIDE:
P0AAJ1
PROSITE:
PS51379
PROSITE:
PS00198
PROTEINMODELPORTAL:
P0AAJ1
REFSEQ:
NP_416106
SMR:
P0AAJ1
UNIPROT:
P0AAJ1


Operon      
Name: ynfEFGH-dmsD         
Operon arrangement:
Transcription unit        Promoter
ynfEFGH-dmsD


Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1875 1664208 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB