RegulonDB RegulonDB 10.7: Gene Form
   

ynfH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ynfH ynfG dmsD TSS_1875 TSS_1875

Gene      
Name: ynfH    Texpresso search in the literature
Synonym(s): ECK1585, G6848, b1590
Genome position(nucleotides): 1663609 --> 1664463 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.63
External database links:  
ASAP:
ABE-0005311
ECHOBASE:
EB3607
OU-MICROARRAY:
b1590
PORTECO:
ynfH
REGULONDB:
b1590
STRING:
511145.b1590
M3D: ynfH
COLOMBOS: ynfH
PortEco: b1590


Product      
Name: putative menaquinol dehydrogenase
Synonym(s): YnfH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 30.524
Isoelectric point: 9.414
Motif(s):
 
Type Positions Sequence
87 -> 107 IAAGSIFFAVGGLWWLVAVIG
149 -> 169 TTLAFFLTVLLSGPILAAAIL
46 -> 66 GMFFLWLLMGVGFIASVMHLG
116 -> 136 LWLLFSMALGVIFVWMMTCVY
1 -> 274 MGNGWHEWPLVIFTVLGQCVVGALIVSGIGWFAAKNDADRQRIVRGMFFLWLLMGVGFIASVMHLGSPLRAFNSLNRIGASGLSNEIAAGSIFFAVGGLWWLVAVIGKMPQALGKLWLLFSMALGVIFVWMMTCVYQIDTVPTWHNGYTTLAFFLTVLLSGPILAAAILRAARVTFNTTPFAIISVLALIACAGVIVLQGLSLASIHSSVQQASALVPDYASLQVWRVVLLCAGLGCWLCPLIRRREPHVAGLILGLILILGGEMIGRVLFYGL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0009390 - dimethyl sulfoxide reductase complex
molecular_function GO:0016491 - oxidoreductase activity
GO:0009389 - dimethyl sulfoxide reductase activity
biological_process GO:0009061 - anaerobic respiration
GO:0019645 - anaerobic electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Geijer P., et al., 2004
External database links:  
ECOCYC:
G6848-MONOMER
ECOLIWIKI:
b1590
INTERPRO:
IPR007059
PANTHER:
PTHR38095
PFAM:
PF04976
PRIDE:
P76173
PROTEINMODELPORTAL:
P76173
REFSEQ:
NP_416107
UNIPROT:
P76173


Operon      
Name: ynfEFGH-dmsD         
Operon arrangement:
Transcription unit        Promoter
ynfEFGH-dmsD


Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1875 1664208 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Geijer P., Weiner JH., 2004, Glutamate 87 is important for menaquinol binding in DmsC of the DMSO reductase (DmsABC) from Escherichia coli., Biochim Biophys Acta 1660(1-2):66-74

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB