RegulonDB RegulonDB 10.7: Gene Form
   

mlc gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mlc ynfL ynfK clcB CRP Mlc mlcp1 mlcp1 mlcp2 mlcp2 ynfKp6 ynfKp6 TSS_1877 TSS_1877 ynfKp5 ynfKp5 TSS_1876 (cluster) TSS_1876 (cluster)

Gene      
Name: mlc    Texpresso search in the literature
Synonym(s): ECK1589, G6852, b1594, dgsA
Genome position(nucleotides): 1667344 <-- 1668564 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.25
External database links:  
ASAP:
ABE-0005323
ECHOBASE:
EB2950
MIM:
269921
MIM:
605820
OU-MICROARRAY:
b1594
PORTECO:
dgsA
REGULONDB:
b1594
STRING:
511145.b1594
M3D: mlc
COLOMBOS: mlc
PortEco: b1594


Product      
Name: DNA-binding transcriptional repressor Mlc
Synonym(s): DgsA, Mlc
Sequence: Get amino acid sequence Fasta Format
Regulator Family: ROK
Cellular location: cytosol
Molecular weight: 44.316
Isoelectric point: 6.186
Motif(s):
 
Type Positions Sequence
257 -> 257 C
33 -> 42 RIDLSRLAQL
96 -> 389 EIFLALRDLSSKLVVEESQELALKDDLPLLDRIISHIDQFFIRHQKKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQLRLNQSMSSMLHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIRQQALPAYSQHISVESTQFSNQGTMAGAAL
179 -> 179 G
259 -> 259 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.9 - cytoplasmic polysaccharides
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.4 - global
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0042802 - identical protein binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006351 - transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[BCE] Binding of cellular extracts
Reference(s): [1] Decker K., et al., 1998
[2] Kim SY., et al., 1999
[3] Plumbridge J. 1998
[4] Plumbridge J. 1998
[5] Tanaka Y., et al., 1999
External database links:  
DIP:
DIP-10219N
ECOCYC:
PD01896
ECOLIWIKI:
b1594
INTERPRO:
IPR036390
INTERPRO:
IPR000600
INTERPRO:
IPR036388
MODBASE:
P50456
PANTHER:
PTHR18964
PDB:
3BP8
PDB:
1Z6R
PFAM:
PF00480
PRIDE:
P50456
PRODB:
PRO_000023242
PROSITE:
PS01125
PROTEINMODELPORTAL:
P50456
REFSEQ:
NP_416111
SMR:
P50456
UNIPROT:
P50456


Operon      
Name: mlc-ynfK         
Operon arrangement:
Transcription unit        Promoter
mlc-ynfK
mlc
 


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: CRP, Mlc


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1876 (cluster) 1667036 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [6]
  promoter ynfKp5 1667240 reverse Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter TSS_1877 1667270 reverse nd [RS-EPT-CBR] [6]
  promoter ynfKp6 1667335 reverse Similarity to the consensus
Read more >
[ICWHO] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Decker K., Plumbridge J., Boos W., 1998, Negative transcriptional regulation of a positive regulator: the expression of malT, encoding the transcriptional activator of the maltose regulon of Escherichia coli, is negatively controlled by Mlc., Mol Microbiol 27(2):381-90

 [2] Kim SY., Nam TW., Shin D., Koo BM., Seok YJ., Ryu S., 1999, Purification of Mlc and analysis of its effects on the pts expression in Escherichia coli., J Biol Chem 274(36):25398-402

 [3] Plumbridge J., 1998, Control of the expression of the manXYZ operon in Escherichia coli: Mlc is a negative regulator of the mannose PTS., Mol Microbiol 27(2):369-80

 [4] Plumbridge J., 1998, Expression of ptsG, the gene for the major glucose PTS transporter in Escherichia coli, is repressed by Mlc and induced by growth on glucose., Mol Microbiol 29(4):1053-63

 [5] Tanaka Y., Kimata K., Inada T., Tagami H., Aiba H., 1999, Negative regulation of the pts operon by Mlc: mechanism underlying glucose induction in Escherichia coli., Genes Cells 4(7):391-9

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB