RegulonDB RegulonDB 10.7: Gene Form
   

ynfL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ynfM mlc ynfL unknown CRP Mlc ynfMp ynfMp ynfLp6 ynfLp6 ynfMp5 ynfMp5 ynfMp4 ynfMp4 mlcp1 mlcp1 mlcp2 mlcp2

Gene      
Name: ynfL    Texpresso search in the literature
Synonym(s): ECK1590, G6853, b1595
Genome position(nucleotides): 1668699 <-- 1669592 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.68
External database links:  
ASAP:
ABE-0005326
ECHOBASE:
EB3611
OU-MICROARRAY:
b1595
PORTECO:
ynfL
REGULONDB:
b1595
STRING:
511145.b1595
M3D: ynfL
COLOMBOS: ynfL
PortEco: b1595


Product      
Name: putative DNA-binding transcriptional regulator
Synonym(s): YnfL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.281
Isoelectric point: 6.576
Motif(s):
 
Type Positions Sequence
1 -> 60 MNIELRHLRYFVAVAEELHFGRAAARLNISQPPLSQQIQALEQQIGARLLARTNRSVLLT
5 -> 64 LRHLRYFVAVAEELHFGRAAARLNISQPPLSQQIQALEQQIGARLLARTNRSVLLTAAGK
20 -> 40 FGRAAARLNISQPPLSQQIQA
88 -> 296 HQGEAGELRIGFTSSAPFIRAVSDTLSLFRRDYPDVHLQTREMNTREQIAPLIEGTLDMGLLRNTALPESLEHAVIVHEPLMAMIPHDHPLANNPNVTLAELAKEPFVFFDPHVGTGLYDDILGLMRRYHLTPVITQEVGEAMTIIGLVSAGLGVSILPASFKRVQLNEMRWVPIAEEDAVSEMWLVWPKHHEQSPAARNFRIHLLNAL

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Perez-Rueda E., et al., 2000
[2] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-12771N
ECOCYC:
G6853-MONOMER
ECOLIWIKI:
b1595
INTERPRO:
IPR005119
INTERPRO:
IPR000847
INTERPRO:
IPR036388
INTERPRO:
IPR036390
MODBASE:
P77559
PFAM:
PF03466
PFAM:
PF00126
PRIDE:
P77559
PRINTS:
PR00039
PROSITE:
PS50931
PROTEINMODELPORTAL:
P77559
REFSEQ:
NP_416112
SMR:
P77559
UNIPROT:
P77559


Operon      
Name: ynfL         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ynfMp4 1669630 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ynfMp5 1669633 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ynfLp6 1669652 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB