RegulonDB RegulonDB 10.7: Gene Form
   

mdtI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydgD mdtJ mdtI ydgV H-NS H-NS TSS_1879 (cluster) TSS_1879 (cluster)

Gene      
Name: mdtI    Texpresso search in the literature
Synonym(s): ECK1594, G6857, b1599, ydgE
Genome position(nucleotides): 1672820 <-- 1673149 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.52
External database links:  
ASAP:
ABE-0005343
ECHOBASE:
EB3685
OU-MICROARRAY:
b1599
PORTECO:
mdtI
REGULONDB:
b1599
STRING:
511145.b1599
M3D: mdtI
COLOMBOS: mdtI
PortEco: b1599


Product      
Name: multidrug/spermidine efflux pump membrane subunit MdtI
Synonym(s): Em109, MdtI, YdgE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 11.72
Isoelectric point: 10.979
Motif(s):
 
Type Positions Sequence
60 -> 60 D
81 -> 81 W
8 -> 30 HAAWLALAIVLEIVANVFLKFSD
68 -> 68 W
6 -> 99 WVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGIDLSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015297 - antiporter activity
GO:0022857 - transmembrane transporter activity
GO:0015606 - spermidine transmembrane transporter activity
GO:0015199 - amino-acid betaine transmembrane transporter activity
GO:0015220 - choline transmembrane transporter activity
biological_process GO:1990961 - xenobiotic detoxification by transmembrane export across the plasma membrane
GO:0015848 - spermidine transport
GO:0055085 - transmembrane transport
GO:0031460 - glycine betaine transport
GO:0015871 - choline transport
GO:1903711 - spermidine transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
B1599-MONOMER
ECOLIWIKI:
b1599
INTERPRO:
IPR023737
INTERPRO:
IPR000390
MODBASE:
P69210
PANTHER:
PTHR30561
PANTHER:
PTHR30561:SF6
PFAM:
PF00893
PRIDE:
P69210
PRODB:
PRO_000023189
PROTEINMODELPORTAL:
P69210
REFSEQ:
NP_416116
SMR:
P69210
UNIPROT:
P69210


Operon      
Name: mdtJI         
Operon arrangement:
Transcription unit        Promoter
 


Transcriptional Regulation      
Display Regulation             
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1879 (cluster) 1671972 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB