RegulonDB RegulonDB 10.8: Gene Form
   

folM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydgI folM rstA ydgC PhoP rstAp rstAp TSS_1894 TSS_1894 ydgCp3 ydgCp3

Gene      
Name: folM    Texpresso search in the literature
Synonym(s): ECK1601, G6862, b1606, ydgB
Genome position(nucleotides): 1680976 --> 1681698 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.9
External database links:  
ASAP:
ABE-0005364
ECHOBASE:
EB2981
NCBI-GENE:
949096
OU-MICROARRAY:
b1606
PortEco:
folM
STRING:
511145.b1606
COLOMBOS: folM


Product      
Name: dihydromonapterin reductase
Synonym(s): FolM, YdgB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.348
Isoelectric point: 8.141
Motif(s):
 
Type Positions Sequence
18 -> 238 IGLALAWHFINQKQPVIVSYRTHYPAIDGLINAGAQCIQADFSTNDGVMAFADEVLKSTHGLRAILHNASAWMAEKPGAPLADVLACMMQIHVNTPYLLNHALERLLRGHGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNSIAPSLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSFPLDGGRH
210 -> 210 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.2 - folic acid
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.17 - formyl-THF biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0004146 - dihydrofolate reductase activity
GO:0071172 - dihydromonapterin reductase activity
biological_process GO:0006730 - one-carbon metabolic process
GO:0009257 - 10-formyltetrahydrofolate biosynthetic process
GO:0046656 - folic acid biosynthetic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
Reference(s): [1] Giladi M., et al., 2003
External database links:  
DIP:
DIP-47981N
ECOCYC:
G6862-MONOMER
ECOLIWIKI:
b1606
INTERPRO:
IPR020904
INTERPRO:
IPR036291
INTERPRO:
IPR002347
MODBASE:
P0AFS3
PANTHER:
PTHR24322
PFAM:
PF13561
PRIDE:
P0AFS3
PRINTS:
PR00081
PRODB:
PRO_000022681
PROSITE:
PS00061
REFSEQ:
NP_416123
SMR:
P0AFS3
UNIPROT:
P0AFS3


Operon      
Name: ydgI-folM         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydgCp3 1682062 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1894 1682136 forward nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Giladi M., Altman-Price N., Levin I., Levy L., Mevarech M., 2003, FolM, a new chromosomally encoded dihydrofolate reductase in Escherichia coli., J Bacteriol 185(23):7015-8

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB