RegulonDB RegulonDB 10.8: Gene Form
   

ydgC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydgI folM rstA ydgC PhoP rstAp rstAp TSS_1894 TSS_1894 ydgCp3 ydgCp3

Gene      
Name: ydgC    Texpresso search in the literature
Synonym(s): ECK1602, G6863, b1607
Genome position(nucleotides): 1681695 <-- 1682030 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.32
External database links:  
ASAP:
ABE-0005366
ECHOBASE:
EB2983
OU-MICROARRAY:
b1607
PortEco:
ydgC
STRING:
511145.b1607
COLOMBOS: ydgC


Product      
Name: GlpM family protein
Synonym(s): YdgC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 12.323
Isoelectric point: 9.75
Motif(s):
 
Type Positions Sequence
59 -> 79 IIFSMWSIIPYFVYLVSLWYF
27 -> 47 YIAGLIPLFPTFALIAHYIVA
88 -> 108 AFVGSVACWGISAWVLIICWI
5 -> 111 IKAALGALVVLLIGVLAKTKNYYIAGLIPLFPTFALIAHYIVASERGIEALRATIIFSMWSIIPYFVYLVSLWYFTGMMRLPAAFVGSVACWGISAWVLIICWIKLH

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6863-MONOMER
ECOLIWIKI:
b1607
INTERPRO:
IPR009707
PFAM:
PF06942
PRIDE:
P0ACX0
PRODOM:
PD028709
REFSEQ:
NP_416124
UNIPROT:
P0ACX0


Operon      
Name: ydgC         
Operon arrangement:
Transcription unit        Promoter
ydgC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydgCp3 1682062 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1894 1682136 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB