RegulonDB RegulonDB 10.8: Gene Form
   

ydgK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rsxA ydgK cnu terminator anti-terminator terminator anti-terminator anti-anti-terminator rsxAp rsxAp TSS_1907 TSS_1907 TSS_1906 TSS_1906 TSS_1905 TSS_1905 ydgKp ydgKp TSS_1904 TSS_1904

Gene      
Name: ydgK    Texpresso search in the literature
Synonym(s): ECK1622, G6870, b1626, rsxP
Genome position(nucleotides): 1705250 --> 1705690 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.75
External database links:  
ASAP:
ABE-0005447
ECHOBASE:
EB3691
OU-MICROARRAY:
b1626
PortEco:
ydgK
STRING:
511145.b1626
COLOMBOS: ydgK


Product      
Name: DUF2569 domain-containing inner membrane protein YdgK
Synonym(s): RsxP, YdgK
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 16.319
Isoelectric point: 11.067
Motif(s):
 
Type Positions Sequence
13 -> 33 LLGPLAWLLVALLSTTLALLL
113 -> 133 GIAVRQLLFTLLATALIVPYF
60 -> 80 VSFITAIALWYYTLWLTIAFF
6 -> 144 PQRIGGWLLGPLAWLLVALLSTTLALLLYTAALSSPQTFQTLGGQALTTQILWGVSFITAIALWYYTLWLTIAFFKRRRCVPKHYIIWLLISVLLAVKAFAFSPVEDGIAVRQLLFTLLATALIVPYFKRSSRVKATFV
90 -> 110 YIIWLLISVLLAVKAFAFSPV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6870-MONOMER
ECOLIWIKI:
b1626
INTERPRO:
IPR019690
PFAM:
PF10754
PRIDE:
P76180
REFSEQ:
NP_416143
UNIPROT:
P76180


Operon      
Name: ydgK-rsxABCDGE-nth         
Operon arrangement:
Transcription unit        Promoter
ydgK-rsxABCDGE-nth
rsxABCDGE-nth


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1904 1705206 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1905 1705217 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1906 1705518 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1907 1705520 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB