RegulonDB RegulonDB 10.8: Gene Form
   

dtpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dtpA nth gstA OmpR GadX terminator anti-terminator anti-anti-terminator terminator gstAp gstAp TSS_1912 TSS_1912 TSS_1911 TSS_1911 tppBp tppBp

Gene      
Name: dtpA    Texpresso search in the literature
Synonym(s): ECK1630, G6877, b1634, tppB, ydgR
Genome position(nucleotides): 1712769 --> 1714271 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.63
External database links:  
ASAP:
ABE-0005469
ECHOBASE:
EB3698
OU-MICROARRAY:
b1634
PortEco:
tppB
STRING:
511145.b1634
COLOMBOS: dtpA


Product      
Name: dipeptide/tripeptide:H+ symporter DtpA
Synonym(s): DtpA, TppB, TppB peptide POT transporter, YdgR
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 53.991
Isoelectric point: 9.048
Motif(s):
 
Type Positions Sequence
89 -> 447 RVIMLGAIVLAIGYALVAWSGHDAGIVYMGMAAIAVGNGLFKANPSSLLSTCYEKNDPRLDGAFTMYYMSVNIGSFFSMIATPWLAAKYGWSVAFALSVVGLLITIVNFAFCQRWVKQYGSKPDFEPINYRNLLLTIIGVVALIAIATWLLHNQEVARMALGVVAFGIVVIFGKEAFAMKGAARRKMIVAFILMLEAIIFFVLYSQMPTSLNFFAIRNVEHSILGLAVEPEQYQALNPFWIIIGSPILAAIYNKMGDTLPMPTKFAIGMVMCSGAFLILPLGAKFASDAGIVSVSWLVASYGLQSIGELMISGLGLAMVAQLVPQRLMGFIMGSWFLTTAGANLIGGYVAGMMAVPDNV
415 -> 435 LMGFIMGSWFLTTAGANLIGG
112 -> 132 AGIVYMGMAAIAVGNGLFKAN
220 -> 240 NLLLTIIGVVALIAIATWLLH
154 -> 174 MYYMSVNIGSFFSMIATPWLA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015293 - symporter activity
GO:0015078 - proton transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
GO:0015333 - peptide:proton symporter activity
GO:0042937 - tripeptide transmembrane transporter activity
GO:0035673 - oligopeptide transmembrane transporter activity
GO:0071916 - dipeptide transmembrane transporter activity
GO:1904680 - peptide transmembrane transporter activity
biological_process GO:0015031 - protein transport
GO:0006857 - oligopeptide transport
GO:0015833 - peptide transport
GO:0042938 - dipeptide transport
GO:0042939 - tripeptide transport
GO:0055085 - transmembrane transport
GO:0035443 - tripeptide transmembrane transport
GO:1902600 - proton transmembrane transport
GO:0035442 - dipeptide transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Alves RA., et al., 1980
[2] Goodell EW., et al., 1987
[3] Kitamura K., et al., 2017
[4] Malle E., et al., 2011
[5] Payne JW., et al., 2001
[6] Prabhala BK., et al., 2017
[7] Smith MW., et al., 1990
[8] Smith MW., et al., 1999
External database links:  
ECOCYC:
B1634-MONOMER
ECOLIWIKI:
b1634
INTERPRO:
IPR000109
INTERPRO:
IPR005279
INTERPRO:
IPR036259
INTERPRO:
IPR020846
INTERPRO:
IPR023517
INTERPRO:
IPR018456
MODBASE:
P77304
PANTHER:
PTHR11654
PDB:
6GS4
PDB:
6GS1
PDB:
6GS7
PFAM:
PF00854
PRIDE:
P77304
PRODB:
PRO_000024094
PROSITE:
PS50850
PROSITE:
PS01023
PROSITE:
PS01022
REFSEQ:
NP_416151
SMR:
P77304
UNIPROT:
P77304


Operon      
Name: dtpA         
Operon arrangement:
Transcription unit        Promoter
tppB


Transcriptional Regulation      
Display Regulation             
Activated by: OmpR
Repressed by: GadX


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1911 1712673 forward nd [RS-EPT-CBR] [9]
  promoter TSS_1912 1713632 forward nd [RS-EPT-CBR] [9]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Alves RA., Payne JW., 1980, The number and nature of the peptide-transport systems of Escherichia coli: characterization of specific transport mutants., Biochem Soc Trans 8(6):704-5

 [2] Goodell EW., Higgins CF., 1987, Uptake of cell wall peptides by Salmonella typhimurium and Escherichia coli., J Bacteriol 169(8):3861-5

 [3] Kitamura K., Kinsui EZ., Abe F., 2017, Critical role of the proton-dependent oligopeptide transporter (POT) in the cellular uptake of the peptidyl nucleoside antibiotic, blasticidin S., Biochim Biophys Acta 1864(2):393-398

 [4] Malle E., Zhou H., Neuhold J., Spitzenberger B., Klepsch F., Pollak T., Bergner O., Ecker GF., Stolt-Bergner PC., 2011, Random mutagenesis of the prokaryotic peptide transporter YdgR identifies potential periplasmic gating residues., J Biol Chem 286(26):23121-31

 [5] Payne JW., Payne GM., Gupta S., Marshall NJ., Grail BM., 2001, Conformational limitations of glycylsarcosine as a prototypic substrate for peptide transporters., Biochim Biophys Acta 1514(1):65-75

 [6] Prabhala BK., Aduri NG., Iqbal M., Rahman M., Gajhede M., Hansen PR., Mirza O., 2017, Several hPepT1-transported drugs are substrates of the Escherichia coli proton-coupled oligopeptide transporter YdgR., Res Microbiol 168(5):443-449

 [7] Smith MW., Payne JW., 1990, Simultaneous exploitation of different peptide permeases by combinations of synthetic peptide smugglins can lead to enhanced antibacterial activity., FEMS Microbiol Lett 58(3):311-6

 [8] Smith MW., Tyreman DR., Payne GM., Marshall NJ., Payne JW., 1999, Substrate specificity of the periplasmic dipeptide-binding protein from Escherichia coli: experimental basis for the design of peptide prodrugs., Microbiology 145 ( Pt 10):2891-901

 [9] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB