RegulonDB RegulonDB 10.8: Gene Form
   

slyB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

anmK slyB slyA PhoP TSS_1926 TSS_1926 TSS_1925 TSS_1925 TSS_1924 TSS_1924 TSS_1923 TSS_1923 TSS_1922 TSS_1922 TSS_1921 TSS_1921 slyBp1 slyBp1 TSS_1919 TSS_1919 TSS_1918 (cluster) TSS_1918 (cluster) slyBp2 slyBp2 anmKp9 anmKp9 TSS_1917 (cluster) TSS_1917 (cluster)

Gene      
Name: slyB    Texpresso search in the literature
Synonym(s): ECK1637, G6881, b1641
Genome position(nucleotides): 1719876 --> 1720343 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.28
External database links:  
ASAP:
ABE-0005493
ECHOBASE:
EB3185
OU-MICROARRAY:
b1641
PortEco:
slyB
STRING:
511145.b1641
COLOMBOS: slyB


Product      
Name: outer membrane lipoprotein SlyB
Synonym(s): SlyB
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 15.602
Isoelectric point: 9.794
Motif(s):
 
Type Positions Sequence
62 -> 102 IGAIGGAVLGGFLGNTVGGGTGRSLATAAGAVAGGVAGQGV
18 -> 155 CVNNDTLSGDVYTASEAKQVQNVSYGTIVNVRPVQIQGGDDSNVIGAIGGAVLGGFLGNTVGGGTGRSLATAAGAVAGGVAGQGVQSAMNKTQGVELEIRKDDGNTIMVVQKQGNTRFSPGQRVVLASNGSQVTVSPR
1 -> 17 MIKRVLVVSMVGLSLVG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0019867 - outer membrane
GO:0016020 - membrane
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
Reference(s): [1] Maddalo G., et al., 2011
External database links:  
ECOCYC:
G6881-MONOMER
ECOLIWIKI:
b1641
INTERPRO:
IPR008816
PFAM:
PF05433
PRIDE:
P0A905
PRODB:
PRO_000023958
PROSITE:
PS51257
REFSEQ:
YP_025304
SMR:
P0A905
UNIPROT:
P0A905


Operon      
Name: slyB         
Operon arrangement:
Transcription unit        Promoter
slyB
slyB


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP
Repressed by: PhoP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1917 (cluster) 1719631 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter anmKp9 1719673 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_1918 (cluster) 1719751 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1919 1719770 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1921 1719780 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1922 1719799 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1923 1719807 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1924 1719829 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1925 1719831 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1926 1720091 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Maddalo G., Stenberg-Bruzell F., Gotzke H., Toddo S., Bjorkholm P., Eriksson H., Chovanec P., Genevaux P., Lehtio J., Ilag LL., Daley DO., 2011, Systematic analysis of native membrane protein complexes in Escherichia coli., J Proteome Res 10(4):1848-59

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB