RegulonDB RegulonDB 10.8: Gene Form
   

ydhJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydhK ydhJ sodC ydhI

Gene      
Name: ydhJ    Texpresso search in the literature
Synonym(s): ECK1640, G6884, b1644
Genome position(nucleotides): 1721264 --> 1722121 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.23
External database links:  
ASAP:
ABE-0005501
ECHOBASE:
EB3702
OU-MICROARRAY:
b1644
PortEco:
ydhJ
STRING:
511145.b1644
COLOMBOS: ydhJ


Product      
Name: putative membrane fusion protein YdhJ
Synonym(s): YdhJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 31.496
Isoelectric point: 8.404
Motif(s):
 
Type Positions Sequence
43 -> 230 EQVSITPQVSGRIVELNIKDNQLVNAGDLLLTIDKTPFQIAELNAQAQLAKAQSDLAKANNEANRRRHLSQNFISAEELDTANLNVKAMQASVDAAQATLKQAQWQLAQTEIRAPVSGWVTNLTTRIGDYADTGKPLFALVDSHSFYVIGYFEETKLRHIREGAPAQITLYSDNKTLQGHVSSIGRAI
6 -> 26 IKYFSTIIVAVVAVLAGWWLW
284 -> 285 GQ
17 -> 276 VAVLAGWWLWNYYMQSPWTRDGKIRAEQVSITPQVSGRIVELNIKDNQLVNAGDLLLTIDKTPFQIAELNAQAQLAKAQSDLAKANNEANRRRHLSQNFISAEELDTANLNVKAMQASVDAAQATLKQAQWQLAQTEIRAPVSGWVTNLTTRIGDYADTGKPLFALVDSHSFYVIGYFEETKLRHIREGAPAQITLYSDNKTLQGHVSSIGRAIYDQSVESDSSLIPDVKPNVPWVRLAQRVPVRFALDKVPGDVTLVSG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
DIP:
DIP-11733N
ECOCYC:
G6884-MONOMER
ECOLIWIKI:
b1644
INTERPRO:
IPR032317
INTERPRO:
IPR006143
MODBASE:
P76185
PFAM:
PF16576
PFAM:
PF00529
PRIDE:
P76185
REFSEQ:
NP_416161
SMR:
P76185
UNIPROT:
P76185


Operon      
Name: ydhIJK         
Operon arrangement:
Transcription unit        Promoter
ydhIJK


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195


RegulonDB