RegulonDB RegulonDB 10.8: Gene Form
   

sodC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydhK ydhF sodC sodCp sodCp

Gene      
Name: sodC    Texpresso search in the literature
Synonym(s): ECK1642, G6886, b1646
Genome position(nucleotides): 1724134 <-- 1724655 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.87
External database links:  
ASAP:
ABE-0005505
ECHOBASE:
EB3195
OU-MICROARRAY:
b1646
PortEco:
sodC
STRING:
511145.b1646
COLOMBOS: sodC


Product      
Name: superoxide dismutase (Cu-Zn)
Synonym(s): SodC, bacteriocuprein
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 17.681
Isoelectric point: 6.389
Motif(s):
 
Type Positions Sequence
20 -> 173 ASEKVEMNLVTSQGVGQSIGSVTITETDKGLEFSPDLKALPPGEHGFHIHAKGSCQPATKDGKASAAESAGGHLDPQNTGKHEGPEGAGHLGDLPALVVNNDGKATDAVIAPRLKSLDEIKDKALMVHVGGDNMSDQPKPLGGGGERYACGVIK
34 -> 172 VGQSIGSVTITETDKGLEFSPDLKALPPGEHGFHIHAKGSCQPATKDGKASAAESAGGHLDPQNTGKHEGPEGAGHLGDLPALVVNNDGKATDAVIAPRLKSLDEIKDKALMVHVGGDNMSDQPKPLGGGGERYACGVI
1 -> 19 MKRFSLAILALVVATGAQA

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0005507 - copper ion binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016209 - antioxidant activity
GO:0008270 - zinc ion binding
GO:0004784 - superoxide dismutase activity
biological_process GO:0006801 - superoxide metabolic process
GO:0019430 - removal of superoxide radicals
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6886-MONOMER
ECOLIWIKI:
b1646
INTERPRO:
IPR024134
INTERPRO:
IPR018152
INTERPRO:
IPR036423
INTERPRO:
IPR001424
MODBASE:
P0AGD1
PANTHER:
PTHR10003
PDB:
1ESO
PFAM:
PF00080
PRIDE:
P0AGD1
PROSITE:
PS00332
REFSEQ:
NP_416163
SMR:
P0AGD1
SWISSMODEL:
P0AGD1
UNIPROT:
P0AGD1


Operon      
Name: sodC         
Operon arrangement:
Transcription unit        Promoter
sodC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB