RegulonDB RegulonDB 10.8: Gene Form
   

ydhL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydhF nemR ydhL RutR NemR terminator nemRp nemRp ydhLp3 ydhLp3 ydhFp3 ydhFp3 ydhFp1 ydhFp1

Gene      
Name: ydhL    Texpresso search in the literature
Synonym(s): ECK1644, G6888, b1648
Genome position(nucleotides): 1725681 <-- 1725920 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.67
External database links:  
ASAP:
ABE-0005510
ECHOBASE:
EB3704
OU-MICROARRAY:
b1648
PortEco:
ydhL
STRING:
511145.b1648
COLOMBOS: ydhL


Product      
Name: DUF1289 domain-containing protein YdhL
Synonym(s): YdhL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.359
Isoelectric point: 8.507
Motif(s):
 
Type Positions Sequence
12 -> 57 SPCRGICQSDERGFCRGCFRSRDERFNWNKMSDGEKQEVLRLCRQR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6888-MONOMER
ECOLIWIKI:
b1648
INTERPRO:
IPR010710
PANTHER:
PTHR35175
PFAM:
PF06945
PRIDE:
P64474
REFSEQ:
NP_416165
UNIPROT:
P64474


Operon      
Name: ydhL         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydhFp1 1725648 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ydhFp3 1725655 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ydhLp3 1725932 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB