RegulonDB RegulonDB 10.8: Gene Form
   

nemR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nemA nemR ydhL RutR NemR terminator nemRp nemRp ydhLp3 ydhLp3

Gene      
Name: nemR    Texpresso search in the literature
Synonym(s): ECK1645, G6889, b1649, ydhM
Genome position(nucleotides): 1726023 --> 1726622 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.33
External database links:  
ASAP:
ABE-0005514
ECHOBASE:
EB3705
OU-MICROARRAY:
b1649
PortEco:
nemR
STRING:
511145.b1649
COLOMBOS: nemR


Product      
Name: DNA-binding transcriptional repressor NemR
Synonym(s): NemR, YdhM
Sequence: Get amino acid sequence Fasta Format
Regulator Family: TetR/AcrR
Cellular location: cytosol
Molecular weight: 22.275
Isoelectric point: 7.0
Motif(s):
 
Type Positions Sequence
30 -> 49 GLSELLKTAEVPKGSFYHYF
84 -> 189 DRILAYYQQTLNQFCQHGTISGCLTVKLSAEVCDLSEDMRSAMDKGARGVIALLSQALENGRENHCLTFCGEPLQQAQVLYALWLGANLQAKISRSFEPLENALAH
7 -> 67 HDTREHLLATGEQLCLQRGFTGMGLSELLKTAEVPKGSFYHYFRSKEAFGVAMLERHYAAY
13 -> 55 LLATGEQLCLQRGFTGMGLSELLKTAEVPKGSFYHYFRSKEAF

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0045892 - negative regulation of transcription, DNA-templated
GO:0051595 - response to methylglyoxal
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[HIFS] Human inference of function from sequence
Reference(s): [1] Perez-Rueda E., et al., 2004
[2] Umezawa Y., et al., 2008
External database links:  
DIP:
DIP-48165N
ECOCYC:
G6889-MONOMER
ECOLIWIKI:
b1649
INTERPRO:
IPR009057
INTERPRO:
IPR036271
INTERPRO:
IPR011075
INTERPRO:
IPR001647
MODBASE:
P67430
PANTHER:
PTHR30328
PDB:
4YZE
PFAM:
PF16925
PFAM:
PF00440
PRIDE:
P67430
PRODB:
PRO_000023370
PROSITE:
PS50977
REFSEQ:
NP_416166
SMR:
P67430
UNIPROT:
P67430


Operon      
Name: nemRA-gloA         
Operon arrangement:
Transcription unit        Promoter
nemRA
nemRA-gloA
gloA
nemA
ydhM


Transcriptional Regulation      
Display Regulation             
Repressed by: NemR, RutR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydhLp3 1725932 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [2] Umezawa Y., Shimada T., Kori A., Yamada K., Ishihama A., 2008, Uncharacterized Transcription Factor YdhM is the Regulator of the nemA Gene Encoding N-ethylmaleimide (NEM) Reductase., J Bacteriol 190(17):5890-7

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB