RegulonDB RegulonDB 10.8: Gene Form
   

gloA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nemA rnt gloA lhrp lhrp TSS_1931 TSS_1931 gloAp gloAp TSS_1930 TSS_1930 TSS_1929 TSS_1929

Gene      
Name: gloA    Texpresso search in the literature
Synonym(s): ECK1647, G6891, b1651
Genome position(nucleotides): 1727837 --> 1728244 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.47
External database links:  
ASAP:
ABE-0005520
ECHOBASE:
EB3197
OU-MICROARRAY:
b1651
PortEco:
gloA
STRING:
511145.b1651
COLOMBOS: gloA


Product      
Name: glyoxalase I
Synonym(s): GloA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.92
Isoelectric point: 4.673
Motif(s):
 
Type Positions Sequence
2 -> 126 RLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVDKYELGTAYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIELIEE
3 -> 123 LLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVDKYELGTAYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIEL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.23 - methylglyoxal metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0004462 - lactoylglutathione lyase activity
GO:0016151 - nickel cation binding
GO:0042803 - protein homodimerization activity
biological_process GO:0019243 - methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione
GO:0009636 - response to toxic substance
Note(s): Note(s): ...[more].
Reference(s): [1] Reiger M., et al., 2015
External database links:  
DIP:
DIP-47995N
ECOCYC:
GLYOXI-MONOMER
ECOLIWIKI:
b1651
INTERPRO:
IPR037523
INTERPRO:
IPR029068
INTERPRO:
IPR018146
INTERPRO:
IPR004361
INTERPRO:
IPR004360
MINT:
MINT-1255986
MODBASE:
P0AC81
PDB:
1FA8
PDB:
1FA7
PDB:
1FA6
PDB:
1FA5
PDB:
1F9Z
PFAM:
PF00903
PRIDE:
P0AC81
PROSITE:
PS00934
PROSITE:
PS00935
PROSITE:
PS51819
REFSEQ:
NP_416168
SMR:
P0AC81
UNIPROT:
P0AC81


Operon      
Name: nemRA-gloA         
Operon arrangement:
Transcription unit        Promoter
nemRA
nemRA-gloA
gloA
nemA
ydhM


Transcriptional Regulation      
Display Regulation             
Repressed by: NemR, RutR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1929 1727798 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1930 1727800 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1931 1727809 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Reiger M., Lassak J., Jung K., 2015, Deciphering the role of the type II glyoxalase isoenzyme YcbL (GlxII-2) in Escherichia coli., FEMS Microbiol Lett 362(2):1-7

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB