RegulonDB RegulonDB 10.9: Gene Form
   

ydhQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mdtK ydhQ valV terminator valVp valVp ydhQp ydhQp TSS_1955 TSS_1955 TSS_1954 TSS_1954 ribCp5 ribCp5

Gene      
Name: ydhQ    Texpresso search in the literature
Synonym(s): ECK1660, G6894, b1664
Genome position(nucleotides): 1744871 <-- 1746127 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.39
External database links:  
ASAP:
ABE-0005563
ECHOBASE:
EB3709
ECOLIHUB:
ydhQ
OU-MICROARRAY:
b1664
STRING:
511145.b1664
COLOMBOS: ydhQ


Product      
Name: putative adhesin-related protein YdhQ
Synonym(s): YdhQ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 42.876
Isoelectric point: 4.164
Motif(s):
 
Type Positions Sequence
329 -> 403 VGNINLNGGKLWLITDAATHVQLKVKRLRGEGAICLQTSAKEISPDFINVKGEVTGDIHVEITDASRQTLCNALK
99 -> 159 NGRHPEGEFSVDKGYACGLLLENGGNLRVLEGHRAEKIILDQEGGLLVNGTTSAVVVDEGG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-28088N
ECOCYC:
G6894-MONOMER
ECOLIWIKI:
b1664
INTERPRO:
IPR012332
INTERPRO:
IPR030930
INTERPRO:
IPR011050
INTERPRO:
IPR004899
PFAM:
PF16168
PFAM:
PF03212
PRIDE:
P77552
REFSEQ:
NP_416181
SMR:
P77552
UNIPROT:
P77552


Operon      
Name: ydhQ         
Operon arrangement:
Transcription unit        Promoter
ydhQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ribCp5 1743458 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1954 1744638 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1955 1746164 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB