RegulonDB RegulonDB 10.8: Gene Form
   

ydhX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydhT ydhU ydhX ydhW ydhTp1 ydhTp1

Gene      
Name: ydhX    Texpresso search in the literature
Synonym(s): ECK1667, G6899, b1671
Genome position(nucleotides): 1750345 <-- 1751013 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.37
External database links:  
ASAP:
ABE-0005583
ECHOBASE:
EB3716
OU-MICROARRAY:
b1671
PortEco:
ydhX
STRING:
511145.b1671
COLOMBOS: ydhX


Product      
Name: putative 4Fe-4S ferredoxin-like protein YdhX
Synonym(s): YdhX
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 25.093
Isoelectric point: 8.244
Motif(s):
 
Type Positions Sequence
37 -> 67 YAMIHDESRCNGCNICARACRKTNHVPAQGS
1 -> 27 MSFTRRKFVLGMGTVIFFTGSASSLLA
84 -> 180 QYHFFRQSCQHCEDAPCIDVCPTGASWRDEQGIVRVEKSQCIGCSYCIGACPYQVRYLNPVTKVADKCDFCAESRLAKGFPPICVSACPEHALIFGR
28 -> 222 NTRQEKEVRYAMIHDESRCNGCNICARACRKTNHVPAQGSRLSIAHIPVTDNDNETQYHFFRQSCQHCEDAPCIDVCPTGASWRDEQGIVRVEKSQCIGCSYCIGACPYQVRYLNPVTKVADKCDFCAESRLAKGFPPICVSACPEHALIFGREDSPEIQAWLQQNKYYQYQLPGAGKPHLYRRFGQHLIKKENV
83 -> 114 TQYHFFRQSCQHCEDAPCIDVCPTGASWRDEQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
molecular_function GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
Note(s): Note(s): ...[more].
Reference(s): [1] Awad A Al Ibrahim N., et al., 2017
External database links:  
DIP:
DIP-48159N
ECOCYC:
G6899-MONOMER
ECOLIWIKI:
b1671
INTERPRO:
IPR017896
INTERPRO:
IPR017900
MODBASE:
P77375
PFAM:
PF13247
PRIDE:
P77375
PROSITE:
PS51379
PROSITE:
PS00198
REFSEQ:
NP_416186
SMR:
P77375
UNIPROT:
P77375


Operon      
Name: ydhYVWXUT         
Operon arrangement:
Transcription unit        Promoter
ydhYVWXUT
 


Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydhTp1 1749569 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Awad A Al Ibrahim N., Green J., 2017, Regulation of the Escherichia coli ydhY-T operon in the presence of alternative electron acceptors., Microbiology 163(4):584-594

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB