RegulonDB RegulonDB 10.8: Gene Form
   

ydhV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydhV ydhW ydhY TSS_1958 TSS_1958

Gene      
Name: ydhV    Texpresso search in the literature
Synonym(s): ECK1669, G6901, b1673
Genome position(nucleotides): 1751728 <-- 1753830 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.98
External database links:  
ASAP:
ABE-0005587
ECHOBASE:
EB3714
OU-MICROARRAY:
b1673
PortEco:
ydhV
STRING:
511145.b1673
COLOMBOS: ydhV


Product      
Name: putative oxidoreductase YdhV
Synonym(s): YdhV
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 77.876
Isoelectric point: 6.751
Motif(s):
 
Type Positions Sequence
228 -> 685 IGANNNHVVPSTPQSWAEYSDPKSRWTARKGLFWGAAEGGPIETGEIPPGNQNTVGFRTYKSVFDLGPAAEKYTVKMSGCHSCPIRCMTQMNIPRVKEFGVPSTGGNTCVANFVHTTIFPNGPKDFEDKDDGRVIGNLVGLNLFDDYGLWCNYGQLHRDFTYCYSKGVFKRVLPAEEYAEIRWDQLEAGDVNFIKDFYYRLAHRVGELSHLADGSYAIAERWNLGEEYWGYAKNKLWSPFGYPVHHANEASAQVGSIVNCMFNRDCMTHTHINFIGSGLPLKLQREVAKELFGSEDAYDETKNYTPINDAKIKYAKWSLLRVCLHNAVTLCNWVWPMTVSPLKSRNYRGDLALEAKFFKAITGEEMTQEKLDLAAERIFTLHRAYTVKLMQTKDMRNEHDLICSWVFDKDPQIPVFTEGTDKMDRDDMHASLTMFYKEMGWDPQLGCPTRETLQRLGL
7 -> 205 GNILRVNLTTGNITLEDSSKFKSFVGGMGFGYKIMYDEVPPGTKPFDEANKLVFATGPLTGSGAPCSSRVNITSLSTFTKGNLVVDAHMGGFFAAQMKFAGYDVIIIEGKAKSPVWLKIKDDKVSLEKADFLWGKGTRATTEEICRLTSPETCVAAIGQAGENLVPLSGMLNSRNHSGGAGTGAIMGSKNLKAIAVEGT

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0016625 - oxidoreductase activity, acting on the aldehyde or oxo group of donors, iron-sulfur protein as acceptor
GO:0043546 - molybdopterin cofactor binding
biological_process GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Awad A Al Ibrahim N., et al., 2017
External database links:  
DIP:
DIP-11741N
ECOCYC:
G6901-MONOMER
ECOLIWIKI:
b1673
INTERPRO:
IPR013983
INTERPRO:
IPR036503
INTERPRO:
IPR036021
INTERPRO:
IPR013985
INTERPRO:
IPR013984
INTERPRO:
IPR001203
MODBASE:
P76192
PFAM:
PF02730
PFAM:
PF01314
PRIDE:
P76192
REFSEQ:
NP_416188
SMART:
SM00790
SMR:
P76192
UNIPROT:
P76192


Operon      
Name: ydhYVWXUT         
Operon arrangement:
Transcription unit        Promoter
ydhYVWXUT
 


Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1958 1752562 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Awad A Al Ibrahim N., Green J., 2017, Regulation of the Escherichia coli ydhY-T operon in the presence of alternative electron acceptors., Microbiology 163(4):584-594

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB