RegulonDB RegulonDB 10.8: Gene Form
   

ydhY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydhV ydhY fumD FNR NarL NarL NarP NarL NarP NarL ydhYp ydhYp TSS_1958 TSS_1958

Gene      
Name: ydhY    Texpresso search in the literature
Synonym(s): ECK1670, G6902, b1674
Genome position(nucleotides): 1753851 <-- 1754477 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.44
External database links:  
ASAP:
ABE-0005589
ECHOBASE:
EB3717
OU-MICROARRAY:
b1674
PortEco:
ydhY
STRING:
511145.b1674
COLOMBOS: ydhY


Product      
Name: putative 4Fe-4S ferredoxin-like protein YdhY
Synonym(s): YdhY
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 22.367
Isoelectric point: 7.936
Motif(s):
 
Type Positions Sequence
59 -> 88 GVLVTQRARCTGCHRCEISCTNFNDGSVGT
116 -> 196 LNYTADTCRQCKEPQCMNVCPIGAITWQQKEGCITVDHKRCIGCSACTTACPWMMATVNTESKKSSKCVLCGECANACPTG
174 -> 203 NTESKKSSKCVLCGECANACPTGALKIIEW
147 -> 176 GCITVDHKRCIGCSACTTACPWMMATVNTE
114 -> 145 GDLNYTADTCRQCKEPQCMNVCPIGAITWQQK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
Note(s): Note(s): ...[more].
Reference(s): [1] Awad A Al Ibrahim N., et al., 2017
External database links:  
ECOCYC:
G6902-MONOMER
ECOLIWIKI:
b1674
INTERPRO:
IPR017900
INTERPRO:
IPR017896
MODBASE:
P0AAL6
PFAM:
PF12800
PFAM:
PF13247
PRIDE:
P0AAL6
PROSITE:
PS51379
PROSITE:
PS00198
REFSEQ:
NP_416189
SMR:
P0AAL6
UNIPROT:
P0AAL6


Operon      
Name: ydhYVWXUT         
Operon arrangement:
Transcription unit        Promoter
ydhYVWXUT
 


Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1958 1752562 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Awad A Al Ibrahim N., Green J., 2017, Regulation of the Escherichia coli ydhY-T operon in the presence of alternative electron acceptors., Microbiology 163(4):584-594

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB