RegulonDB RegulonDB 10.8: Gene Form
   

sufE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sufS ldtE sufE sufD sufEp3 sufEp3 ynhGp4 ynhGp4 ynhGp7 ynhGp7 TSS_1985 TSS_1985 TSS_1984 TSS_1984

Gene      
Name: sufE    Texpresso search in the literature
Synonym(s): ECK1675, G6905, b1679, ynhA
Genome position(nucleotides): 1758874 <-- 1759290 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.68
External database links:  
ASAP:
ABE-0005608
ECHOBASE:
EB3719
OU-MICROARRAY:
b1679
PortEco:
sufE
STRING:
511145.b1679
COLOMBOS: sufE


Product      
Name: sulfur carrier protein SufE
Synonym(s): SufE, YnhA, sulfur acceptor for SufS cysteine desulfurase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.8
Isoelectric point: 5.919
Motif(s):
 
Type Positions Sequence
12 -> 132 RNFLRCANWEEKYLYIIELGQRLPELRDEDRSPQNSIQGCQSQVWIVMRQNAQGIIELQGDSDAAIVKGLIAVVFILYDQMTPQDIVNFDVRPWFEKMALTQHLTPSRSQGLEAMIRAIRA
51 -> 51 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.19 - incorporation of metal ions
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008047 - enzyme activator activity
GO:0097163 - sulfur carrier activity
biological_process GO:0006790 - sulfur compound metabolic process
GO:0006979 - response to oxidative stress
GO:0016226 - iron-sulfur cluster assembly
GO:0031162 - sulfur incorporation into metallo-sulfur cluster
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Arunasri K., et al., 2013
[2] Dunkle JA., et al., 2019
[3] Kim D., et al., 2018
[4] Kim S., et al., 2013
[5] Liu G., et al., 2005
[6] Outten FW., et al., 2003
External database links:  
DIP:
DIP-10941N
ECOCYC:
G6905-MONOMER
ECOLIWIKI:
b1679
INTERPRO:
IPR023939
INTERPRO:
IPR003808
MODBASE:
P76194
PANTHER:
PTHR43597
PDB:
1MZG
PFAM:
PF02657
PRIDE:
P76194
PRODB:
PRO_000024009
REFSEQ:
NP_416194
SMR:
P76194
UNIPROT:
P76194


Operon      
Name: sufABCDSE         
Operon arrangement:
Transcription unit        Promoter
sufABCDSE


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, IscR, OxyR
Repressed by: NsrR, Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1984 1758859 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_1985 1758864 reverse nd [RS-EPT-CBR] [7]
  promoter ynhGp7 1758944 reverse Similarity to the consensus
Read more >
[ICWHO] [8]
  promoter ynhGp4 1758945 reverse Similarity to the consensus
Read more >
[ICWHO] [8]
  promoter sufEp3 1759481 reverse Similarity to the consensus
Read more >
[ICWHO] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Arunasri K., Adil M., Venu Charan K., Suvro C., Himabindu Reddy S., Shivaji S., 2013, Effect of simulated microgravity on E. coli K12 MG1655 growth and gene expression., PLoS One 8(3):e57860

 [2] Dunkle JA., Bruno MR., Outten FW., Frantom PA., 2019, Structural Evidence for Dimer-Interface-Driven Regulation of the Type II Cysteine Desulfurase, SufS., Biochemistry 58(6):687-696

 [3] Kim D., Singh H., Dai Y., Dong G., Busenlehner LS., Outten FW., Frantom PA., 2018, Changes in Protein Dynamics in Escherichia coli SufS Reveal a Possible Conserved Regulatory Mechanism in Type II Cysteine Desulfurase Systems., Biochemistry 57(35):5210-5217

 [4] Kim S., Park S., 2013, Structural changes during cysteine desulfurase CsdA and sulfur acceptor CsdE interactions provide insight into the trans-persulfuration., J Biol Chem 288(38):27172-80

 [5] Liu G., Li Z., Chiang Y., Acton T., Montelione GT., Murray D., Szyperski T., 2005, High-quality homology models derived from NMR and X-ray structures of E. coli proteins YgdK and Suf E suggest that all members of the YgdK/Suf E protein family are enhancers of cysteine desulfurases., Protein Sci 14(6):1597-608

 [6] Outten FW., Wood MJ., Munoz FM., Storz G., 2003, The SufE protein and the SufBCD complex enhance SufS cysteine desulfurase activity as part of a sulfur transfer pathway for Fe-S cluster assembly in Escherichia coli., J Biol Chem 278(46):45713-9

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [8] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB