RegulonDB RegulonDB 10.8: Gene Form
   

sufC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sufB sufD sufS sufC sufEp3 sufEp3

Gene      
Name: sufC    Texpresso search in the literature
Synonym(s): ECK1678, G6908, b1682, ynhD
Genome position(nucleotides): 1761766 <-- 1762512 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.47
External database links:  
ASAP:
ABE-0005619
ECHOBASE:
EB3722
OU-MICROARRAY:
b1682
PortEco:
sufC
STRING:
511145.b1682
COLOMBOS: sufC


Product      
Name: Fe-S cluster scaffold complex subunit SufC
Synonym(s): SufC, SufC component of SufBCD Fe-S cluster scaffold complex, YnhD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.582
Isoelectric point: 4.596
Motif(s):
 
Type Positions Sequence
34 -> 41 GPNGSGKS
2 -> 246 LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGWLTE
17 -> 172 LRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDES

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.19 - incorporation of metal ions
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
Gene Ontology Terms (GO)  
cellular_component GO:1990229 - iron-sulfur cluster assembly complex
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0016226 - iron-sulfur cluster assembly
GO:0009314 - response to radiation
Note(s): Note(s): ...[more].
Reference(s): [1] Chahal HK., et al., 2012
[2] Jindal S., et al., 2019
External database links:  
DIP:
DIP-10939N
ECOCYC:
G6908-MONOMER
ECOLIWIKI:
b1682
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR003593
INTERPRO:
IPR003439
INTERPRO:
IPR010230
MINT:
P77499
MODBASE:
P77499
PANTHER:
PTHR43204:SF1
PDB:
5AWF
PDB:
2ZU0
PDB:
2D3W
PDB:
5AWG
PFAM:
PF00005
PRIDE:
P77499
PROSITE:
PS50893
PROSITE:
PS00211
REFSEQ:
NP_416197
SMART:
SM00382
SMR:
P77499
SWISSMODEL:
P77499
UNIPROT:
P77499


Operon      
Name: sufABCDSE         
Operon arrangement:
Transcription unit        Promoter
sufABCDSE


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, IscR, OxyR
Repressed by: NsrR, Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter sufEp3 1759481 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Chahal HK., Outten FW., 2012, Separate FeS scaffold and carrier functions for SufB2C2 and SufA during in vitro maturation of [2Fe2S] Fdx., J Inorg Biochem 116:126-34

 [2] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB