RegulonDB RegulonDB 10.8: Gene Form
   

menI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydiJ ydiK menI ydiH terminator TSS_1988 TSS_1988 TSS_1987 TSS_1987 ydiHp2 ydiHp2 ydiHp3 ydiHp3 TSS_1986 TSS_1986

Gene      
Name: menI    Texpresso search in the literature
Synonym(s): ECK1683, G6912, b1686, ydiI
Genome position(nucleotides): 1765222 <-- 1765632 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.58
External database links:  
ASAP:
ABE-0005628
ECHOBASE:
EB3725
OU-MICROARRAY:
b1686
PortEco:
ydiI
STRING:
511145.b1686
COLOMBOS: menI


Product      
Name: 1,4-dihydroxy-2-naphthoyl-CoA hydrolase
Synonym(s): MenI, YdiI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.945
Isoelectric point: 7.512
Motif(s):
 
Type Positions Sequence
54 -> 54 H
64 -> 64 S
50 -> 127 FGLLHGGASVVLAESIGSVAGYLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEIFDEKGRLCC
67 -> 67 S
63 -> 63 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0016790 - thiolester hydrolase activity
GO:0016289 - CoA hydrolase activity
GO:0061522 - 1,4-dihydroxy-2-naphthoyl-CoA thioesterase activity
biological_process GO:0009234 - menaquinone biosynthetic process
External database links:  
DIP:
DIP-11750N
ECOCYC:
G6912-MONOMER
ECOLIWIKI:
b1686
INTERPRO:
IPR003736
INTERPRO:
IPR006683
INTERPRO:
IPR029069
INTERPRO:
IPR030863
MODBASE:
P77781
PDB:
4K4B
PDB:
4K49
PDB:
1VI8
PDB:
1VH5
PDB:
1SBK
PDB:
4K4A
PFAM:
PF03061
PRIDE:
P77781
REFSEQ:
NP_416201
SMR:
P77781
UNIPROT:
P77781


Operon      
Name: ydiJ-menI-ydiH         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1986 1765146 reverse nd [RS-EPT-CBR] [1]
  promoter ydiHp3 1765147 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ydiHp2 1765291 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1987 1767630 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1988 1768977 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB