RegulonDB RegulonDB 10.8: Gene Form
   

ydiL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydiM ydiL rprA terminator anti-terminator anti-anti-terminator ydiMp1 ydiMp1 ydiMp5 ydiMp5 rprAp rprAp

Gene      
Name: ydiL    Texpresso search in the literature
Synonym(s): ECK1687, G6915, b1689
Genome position(nucleotides): 1770615 --> 1770971 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.66
External database links:  
ASAP:
ABE-0005641
ECHOBASE:
EB3728
OU-MICROARRAY:
b1689
PortEco:
ydiL
STRING:
511145.b1689
COLOMBOS: ydiL


Product      
Name: DUF1870 domain-containing protein YdiL
Synonym(s): YdiL
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 13.929
Isoelectric point: 6.927
Motif(s):
 
Type Positions Sequence
1 -> 118 MNAYELQALRHIFAMTIDECATWIAQTGDSESWRQWENGKCAIPDRVVEQLLAMRQQRKKHLHAIIEKINNRIGNNTMRFFPDLTAFQRVYPDGNFIDWKIYQSVAAELYAHDLERLC

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0003677 - DNA binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6915-MONOMER
ECOLIWIKI:
b1689
INTERPRO:
IPR010982
INTERPRO:
IPR027910
INTERPRO:
IPR015060
PFAM:
PF08965
PRIDE:
P76196
REFSEQ:
NP_416204
SMR:
P76196
SWISSMODEL:
P76196
UNIPROT:
P76196


Operon      
Name: ydiL         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydiMp5 1770926 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ydiMp1 1770930 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB