RegulonDB RegulonDB 10.8: Gene Form
   

ydiP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydiO ydiP ydiQ anti-terminator terminator ydiPp ydiPp

Gene      
Name: ydiP    Texpresso search in the literature
Synonym(s): ECK1694, G6919, b1696
Genome position(nucleotides): 1778390 <-- 1779301 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.0
External database links:  
ASAP:
ABE-0005660
ECHOBASE:
EB3732
OU-MICROARRAY:
b1696
PortEco:
ydiP
STRING:
511145.b1696
COLOMBOS: ydiP


Product      
Name: putative DNA-binding transcriptional regulator YdiP
Synonym(s): YdiP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.894
Isoelectric point: 6.985
Motif(s):
 
Type Positions Sequence
202 -> 281 LSKKFRASVSYICHEFTKEYRISPINYVIQRRMTEAKWSLTNTELSQAEISWRVGYENVDHFAKLFLRHVGCSPSDYRRQ
27 -> 157 FSDDPKWESGHHVHDNETELIYVKKGVARFTIDSSLYVAHADDIVVIERGRLHAVASDVNDPATTCTCALYGFQFQGAEENQLLQPHSCPVIAAGQGKEVIKTLFNELSVILPQSKNSQTSSLWDAFAYTL
183 -> 281 KDILFYLNNNYREKITLEQLSKKFRASVSYICHEFTKEYRISPINYVIQRRMTEAKWSLTNTELSQAEISWRVGYENVDHFAKLFLRHVGCSPSDYRRQ
200 -> 221 EQLSKKFRASVSYICHEFTKEY
248 -> 271 QAEISWRVGYENVDHFAKLFLRHV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Paradis-Bleau C., et al., 2014
[2] Perez-Rueda E., et al., 2000
[3] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-11757N
ECOCYC:
G6919-MONOMER
ECOLIWIKI:
b1696
INTERPRO:
IPR011051
INTERPRO:
IPR018060
INTERPRO:
IPR014710
INTERPRO:
IPR009057
INTERPRO:
IPR003313
MODBASE:
P77402
PFAM:
PF02311
PFAM:
PF12833
PRIDE:
P77402
PROSITE:
PS01124
REFSEQ:
NP_416211
SMART:
SM00342
SMR:
P77402
UNIPROT:
P77402


Operon      
Name: ydiP         
Operon arrangement:
Transcription unit        Promoter
ydiP


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [3] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50


RegulonDB