RegulonDB RegulonDB 10.6.3: Gene Form
   

ydiV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydiU ydiV nlpC SdiA IscR terminator TSS_1999 TSS_1999 TSS_1998 TSS_1998 TSS_1997 TSS_1997 ydiVp ydiVp ydiUp ydiUp

Gene      
Name: ydiV    Texpresso search in the literature
Synonym(s): ECK1705, G6925, b1707, rflP
Genome position(nucleotides): 1791307 <-- 1792020 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.3
External database links:  
ASAP:
ABE-0005696
ECHOBASE:
EB3738
ECOCYC:
G6925
ECOLIHUB:
ydiV
OU-MICROARRAY:
b1707
REGULONDB:
b1707
STRING:
511145.b1707
M3D: ydiV
COLOMBOS: ydiV
PortEco: b1707


Product      
Name: anti-FlhDC factor
Synonym(s): RflP, YdiV
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 27.046
Isoelectric point: 5.817
Motif(s):
 
Type Positions Sequence
1 -> 237 MKIFLENLYHSDCYFLPIRDNQQVLVGVELITHFSSEDGTVRIPTSRVIAQLTEEQHWQLFSEQLELLKSCQHFFIQHKLFAWLNLTPQVATLLLERDNYAGELLKYPFIELLINENYPHLNEGKDNRGLLSLSQVYPLVLGNLGAGNSTMKAVFDGLFTRVMLDKSFIQQQITHRSFEPFIRAIQAQISPCCNCIIAGGIDTAEILAQITPFDFHALQGCLWPAVPINQITTLVQR
13 -> 222 CYFLPIRDNQQVLVGVELITHFSSEDGTVRIPTSRVIAQLTEEQHWQLFSEQLELLKSCQHFFIQHKLFAWLNLTPQVATLLLERDNYAGELLKYPFIELLINENYPHLNEGKDNRGLLSLSQVYPLVLGNLGAGNSTMKAVFDGLFTRVMLDKSFIQQQITHRSFEPFIRAIQAQISPCCNCIIAGGIDTAEILAQITPFDFHALQGCL

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
Gene Ontology Terms (GO)  
molecular_function GO:0008134 - transcription factor binding
biological_process GO:0043433 - negative regulation of DNA-binding transcription factor activity
GO:2000678 - negative regulation of transcription regulatory region DNA binding
GO:1902201 - negative regulation of bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Wada T., et al., 2012
External database links:  
DIP:
DIP-11763N
ECOCYC:
G6925-MONOMER
ECOLIWIKI:
b1707
INTERPRO:
IPR035919
INTERPRO:
IPR001633
PDB:
4ES4
PDB:
3TLQ
PFAM:
PF00563
PRIDE:
P76204
PROSITE:
PS50883
PROTEINMODELPORTAL:
P76204
REFSEQ:
NP_416222
SMR:
P76204
UNIPROT:
P76204


Operon      
Name: ydiV         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Activated by: SdiA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1997 1792156 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1998 1792191 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1999 1792637 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Wada T., Hatamoto Y., Kutsukake K., 2012, Functional and expressional analyses of the anti-FlhD4C2 factor gene ydiV in Escherichia coli., Microbiology 158(Pt 6):1533-42

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB