RegulonDB RegulonDB 10.8: Gene Form
   

arpB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

thrS arpB yniD NsrR DksA-ppGpp DksA-ppGpp DksA-ppGpp DksA-ppGpp DksA-ppGpp DksA-ppGpp terminator yniDp6 yniDp6 thrSp thrSp TSS_2036 TSS_2036 TSS_2035 TSS_2035 TSS_2034 TSS_2034 TSS_2033 (cluster) TSS_2033 (cluster) TSS_2032 TSS_2032 TSS_2031 TSS_2031 TSS_2030 TSS_2030 TSS_2029 TSS_2029 infCp infCp TSS_2027 TSS_2027 TSS_2026 TSS_2026 TSS_2025 (cluster) TSS_2025 (cluster) TSS_2024 TSS_2024 infCp2 infCp2 TSS_2023 TSS_2023

Gene      
Name: arpB    Texpresso search in the literature
Synonym(s): ECK1718, G6926, b1720, b1721, b4494, ydiW, ydiX
Type: Pseudo Gene
Genome position(nucleotides): 1803094 --> 1804993 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
39.05
External database links:  
ASAP:
ABE-0005740
ASAP:
ABE-0005742
ASAP:
ABE-0285095
OU-MICROARRAY:
b1720
OU-MICROARRAY:
b1721
PortEco:
arpB_1
PortEco:
arpB_2
UNIPROT:
P76205
COLOMBOS: arpB


Product      
Name: putative ankyrin repeat protein B, N-terminal fragment
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 9.648
Motif(s):
 
Type Positions Sequence
1 -> 157 MSQNDIIIRTHYKSPHRLHIDSDIPTPSSEPINQFARQLITLLDTSDLSSMLSYCVTQEFTANCRKISQNCYSTALFTINFATSPIHTENILITLHYKKEIISLLLETTPIKANHLRSILDYIEQEQLTAEDRNHCMKLSKKIHREKNYTPNSKSQW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9160N
ECOCYC:
G6926-MONOMER
ECOLIWIKI:
b1720
INTERPRO:
IPR012927
INTERPRO:
IPR020683
PRIDE:
P76205
PROSITE:
PS50297
PROSITE:
PS50088
SMART:
SM00248
SMR:
P76205
UNIPROT:
P76205


Operon      
Name: arpB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2023 1800817 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2024 1800819 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2025 (cluster) 1801170 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2026 1801273 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2027 1801278 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2029 1801426 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2030 1801552 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2031 1801633 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2032 1802563 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2033 (cluster) 1802626 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2034 1802634 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2035 1802637 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2036 1802699 reverse nd [RS-EPT-CBR] [1]
  promoter yniDp6 1805101 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB