RegulonDB RegulonDB 10.8: Gene Form
   

yniB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yniA hxpB yniB anti-terminator TSS_2043 TSS_2043 TSS_2042 (cluster) TSS_2042 (cluster) hxpBp hxpBp yniBp yniBp TSS_2041 TSS_2041

Gene      
Name: yniB    Texpresso search in the literature
Synonym(s): ECK1724, G6931, b1726
Genome position(nucleotides): 1808697 <-- 1809233 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.95
External database links:  
ASAP:
ABE-0005757
ECHOBASE:
EB3743
OU-MICROARRAY:
b1726
PortEco:
yniB
STRING:
511145.b1726
COLOMBOS: yniB


Product      
Name: uncharacterized protein YniB
Synonym(s): YniB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 20.367
Isoelectric point: 8.478
Motif(s):
 
Type Positions Sequence
15 -> 177 ILGWVIFIPALISTLISLLKFMNTRQENKEGINAVMLDFTHVMIDMMQANTPFLNLFWYNSPTPNFNGGVNVMFWVIFILIFVGLALQDSGARMSRQARFLREGVEDQLILEKAKGEEGLTREQIESRIVVPHHTIFLQFFSLYILPVICIAAGYVFFSLLGF
158 -> 178 YILPVICIAAGYVFFSLLGFI
80 -> 100 FNGGVNVMFWVIFILIFVGLA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12776N
ECOCYC:
G6931-MONOMER
ECOLIWIKI:
b1726
INTERPRO:
IPR025229
PFAM:
PF14002
PRIDE:
P76208
REFSEQ:
NP_416240
UNIPROT:
P76208


Operon      
Name: yniB         
Operon arrangement:
Transcription unit        Promoter
yniB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2041 1809262 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2042 (cluster) 1809339 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2043 1809350 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB