RegulonDB RegulonDB 10.8: Gene Form
   

cedA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

katE ydjO cedA Fis terminator anti-terminator katEp katEp cedAp cedAp ydjOp4 ydjOp4 ydjOp10 ydjOp10 ydjOp7 ydjOp7 ydjOp9 ydjOp9

Gene      
Name: cedA    Texpresso search in the literature
Synonym(s): ECK1729, G6936, b1731, ydjP
Genome position(nucleotides): 1813421 <-- 1813663 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.26
Reference(s): [1] Katayama T., et al., 1997
External database links:  
ASAP:
ABE-0005776
ECHOBASE:
EB3748
OU-MICROARRAY:
b1731
PortEco:
cedA
STRING:
511145.b1731
COLOMBOS: cedA


Shine dalgarno      
Sequence: tatgcgtttaGTGAAGccagtAAT


Product      
Name: cell division modulator
Synonym(s): CedA, YdjP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.377
Isoelectric point: 10.218
Motif(s):
 
Type Positions Sequence
3 -> 78 KPLRQQNRQIISYVPRTEPAPPEHAIKMDSFRDVWMLRGKYVAFVLMGESFLRSPAFTVPESAQRWANQIRQEGEV

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003690 - double-stranded DNA binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0051302 - regulation of cell division
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IGI] Inferred from genetic interaction
[IMP] Inferred from mutant phenotype
Reference(s): [2] Chen HA., et al., 2005
[1] Katayama T., et al., 1997
External database links:  
DIP:
DIP-47928N
ECOCYC:
G6936-MONOMER
ECOLIWIKI:
b1731
INTERPRO:
IPR038463
INTERPRO:
IPR019666
PDB:
2D35
PDB:
2BN8
PFAM:
PF10729
PRIDE:
P0AE60
PRODB:
PRO_000022267
REFSEQ:
NP_416245
SMR:
P0AE60
UNIPROT:
P0AE60


Operon      
Name: cedA         
Operon arrangement:
Transcription unit        Promoter
cedA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydjOp9 1813153 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ydjOp7 1813188 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ydjOp10 1813255 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ydjOp4 1813348 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Katayama T., Takata M., Sekimizu K., 1997, CedA is a novel Escherichia coli protein that activates the cell division inhibited by chromosomal DNA over-replication., Mol Microbiol 26(4):687-97

 [2] Chen HA., Simpson P., Huyton T., Roper D., Matthews S., 2005, Solution structure and interactions of the Escherichia coli cell division activator protein CedA., Biochemistry 44(18):6738-44

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB