RegulonDB RegulonDB 10.8: Gene Form
   

ves gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cho ves spy nadE spy3\' LexA vesp vesp chop chop

Gene      
Name: ves    Texpresso search in the literature
Synonym(s): ECK1740, G6938, b1742, ydjR
Genome position(nucleotides): 1824362 <-- 1824937 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.91
External database links:  
ASAP:
ABE-0005809
ECHOBASE:
EB3750
OU-MICROARRAY:
b1742
PortEco:
ves
STRING:
511145.b1742
COLOMBOS: ves


Product      
Name: HutD family protein Ves
Synonym(s): Ves, YdjR
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 21.577
Isoelectric point: 8.492
Motif(s):
 
Type Positions Sequence
5 -> 175 DMRKMSVNLWRNAAGETREICTFPPAKRDFYWRASIASIAANGEFSLFPGMERIVTLLEGGEMLLESADRFNHTLKPFQPFAFAADQVVKAKLTAGQMSMDFNIMTRLDVCKAKVRIAERTFTTFGSRGGVVFVINGAWQLGDKLLTTDQGACWFDGRHTLRLLQPQGKLL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
biological_process GO:0070417 - cellular response to cold
Note(s): Note(s): ...[more].
Evidence: [IHBCE] Inferred by a human based on computational evidence
Reference(s): [1] Ghosal A., et al., 2015
[2] Yamada M., et al., 2002
External database links:  
DIP:
DIP-11778N
ECOCYC:
G6938-MONOMER
ECOLIWIKI:
b1742
INTERPRO:
IPR010282
INTERPRO:
IPR023482
INTERPRO:
IPR014710
INTERPRO:
IPR011051
PANTHER:
PTHR37943
PFAM:
PF05962
PRIDE:
P76214
PRODB:
PRO_000024210
REFSEQ:
NP_416256
SMR:
P76214
UNIPROT:
P76214


Operon      
Name: ves         
Operon arrangement:
Transcription unit        Promoter
ves


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Ghosal A., Upadhyaya BB., Fritz JV., Heintz-Buschart A., Desai MS., Yusuf D., Huang D., Baumuratov A., Wang K., Galas D., Wilmes P., 2015, The extracellular RNA complement of Escherichia coli., Microbiologyopen

 [2] Yamada M., Nagamitsu H., Izu H., Nakamura K., Talukder AA., 2002, Characterization of the ves gene, which is expressed at a low temperature in Escherichia coli., J Mol Microbiol Biotechnol 4(2):163-9


RegulonDB