RegulonDB RegulonDB 10.8: Gene Form
   

astE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

astD astB astE spy astA BaeR BaeR CpxR astEp3 astEp3 TSS_2054 TSS_2054 spyp spyp TSS_2053 TSS_2053

Gene      
Name: astE    Texpresso search in the literature
Synonym(s): ECK1742, G6940, b1744, ydjS
Genome position(nucleotides): 1825955 <-- 1826923 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.35
External database links:  
ASAP:
ABE-0005815
ECHOBASE:
EB3751
OU-MICROARRAY:
b1744
PortEco:
astE
STRING:
511145.b1744
COLOMBOS: astE


Product      
Name: succinylglutamate desuccinylase
Synonym(s): AstE, YdjS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.8
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
45 -> 320 ALVISAGIHGNETAPVEMLDALLGAISHGEIPLRWRLLVILGNPPALKQGKRYCHSDMNRMFGGRWQLFAESGETCRARELEQCLEDFYDQGKESVRWHLDLHTAIRGSLHPQFGVLPQRDIPWDEKFLTWLGAAGLEALVFHQEPGGTFTHFSARHFGALACTLELGKALPFGQNDLRQFAVTASAIAALLSGESVGIVRTPPLRYRVVSQITRHSPSFEMHMASDTLNFMPFEKGTLLAQDGEERFTVTHDVEYVLFPNPLVALGLRAGLMLEK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016788 - hydrolase activity, acting on ester bonds
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0016811 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0008270 - zinc ion binding
GO:0009017 - succinylglutamate desuccinylase activity
biological_process GO:0006525 - arginine metabolic process
GO:0019544 - arginine catabolic process to glutamate
GO:0019545 - arginine catabolic process to succinate
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
SUCCGLUDESUCC-MONOMER
ECOLIWIKI:
b1744
INTERPRO:
IPR007036
INTERPRO:
IPR016681
MODBASE:
P76215
PDB:
1YW6
PFAM:
PF04952
PRIDE:
P76215
PRODB:
PRO_000022179
REFSEQ:
NP_416258
SMR:
P76215
UNIPROT:
P76215


Operon      
Name: astCADBE         
Operon arrangement:
Transcription unit        Promoter
astCADBE
astCADBE
astCADBE


Transcriptional Regulation      
Display Regulation             
Activated by: NtrC, ArgR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2053 1825686 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2054 1825737 reverse nd [RS-EPT-CBR] [1]
  promoter astEp3 1827069 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB