RegulonDB RegulonDB 10.8: Gene Form
   

ydjX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

xthA ydjX ydjY TSS_2060 TSS_2060 TSS_2059 TSS_2059 TSS_2058 TSS_2058 TSS_2057 TSS_2057 TSS_2056 TSS_2056 ydjXp1 ydjXp1 ydjXp5 ydjXp5

Gene      
Name: ydjX    Texpresso search in the literature
Synonym(s): ECK1748, G6945, b1750
Genome position(nucleotides): 1833401 --> 1834111 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.1
External database links:  
ASAP:
ABE-0005832
ECHOBASE:
EB3756
OU-MICROARRAY:
b1750
PortEco:
ydjX
STRING:
511145.b1750
COLOMBOS: ydjX


Product      
Name: DedA family protein YdjX
Synonym(s): YdjX
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 26.058
Isoelectric point: 9.516
Motif(s):
 
Type Positions Sequence
73 -> 183 GIVFGPLLGTLLSLIAATLASSCSFLLARWLGRDLLLKYVGHSNTFQAIEKGIARNGIDFLILTRLIPLFPYNIQNYAYGLTTIAFWPYTLISALTTLPGIVIYTVMASDL
7 -> 27 FLFACLIFALVIYAIHAFGLF
50 -> 70 LYILLFIIATLLLLPGSILVI
156 -> 176 IAFWPYTLISALTTLPGIVIY
63 -> 179 LPGSILVIAGGIVFGPLLGTLLSLIAATLASSCSFLLARWLGRDLLLKYVGHSNTFQAIEKGIARNGIDFLILTRLIPLFPYNIQNYAYGLTTIAFWPYTLISALTTLPGIVIYTVM

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11779N
ECOCYC:
G6945-MONOMER
ECOLIWIKI:
b1750
INTERPRO:
IPR032816
PANTHER:
PTHR12677
PFAM:
PF09335
PRIDE:
P76219
REFSEQ:
NP_416264
UNIPROT:
P76219


Operon      
Name: ydjXYZ-ynjABCD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydjXp5 1833217 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ydjXp1 1833308 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2056 1833345 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2057 1833569 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2058 1833986 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2059 1834126 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2060 1834129 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB