RegulonDB RegulonDB 10.8: Gene Form
   

ydjY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydjX ydjZ ydjY TSS_2062 (cluster) TSS_2062 (cluster) TSS_2061 TSS_2061 TSS_2060 TSS_2060 TSS_2059 TSS_2059 TSS_2058 TSS_2058 TSS_2057 TSS_2057

Gene      
Name: ydjY    Texpresso search in the literature
Synonym(s): ECK1749, G6946, b1751
Genome position(nucleotides): 1834116 --> 1834793 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.38
External database links:  
ASAP:
ABE-0005834
ECHOBASE:
EB3757
OU-MICROARRAY:
b1751
PortEco:
ydjY
STRING:
511145.b1751
COLOMBOS: ydjY


Product      
Name: 4Fe-4S ferredoxin-type domain-containing protein YdjY
Synonym(s): YdjY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.125
Isoelectric point: 6.664
Motif(s):
 
Type Positions Sequence
161 -> 190 GNLTAAEEKKTGCLVCLDSCPVGIVSNATY
23 -> 225 GLSGCDQQENAAAKVEYDGLSNSQPLRVDANNHTVTMLVQINGRFLTDDTRHGIVFKDGSNGHKSLFMGYATPKAFYEALKEAGGTPGENMTMDNKETTHVTGSKLDISVNWQGAAKAYSFDEVIVDSNGKKLDMRFGGNLTAAEEKKTGCLVCLDSCPVGIVSNATYTYGAVEKRGEVKFKGNASVLPADNTLATVTFKIAE
1 -> 22 MLQHYSVSWKKGLAALCLLAVA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6946-MONOMER
ECOLIWIKI:
b1751
INTERPRO:
IPR017896
PRIDE:
P76220
PROSITE:
PS51379
REFSEQ:
NP_416265
SMR:
P76220
UNIPROT:
P76220


Operon      
Name: ydjXYZ-ynjABCD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2057 1833569 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2058 1833986 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2059 1834126 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2060 1834129 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2061 1835147 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2062 (cluster) 1835149 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB