RegulonDB RegulonDB 10.8: Gene Form
   

ydjZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ynjB ydjZ ydjY ynjA ynjC TSS_2062 (cluster) TSS_2062 (cluster) TSS_2061 TSS_2061 TSS_2060 TSS_2060 TSS_2059 TSS_2059

Gene      
Name: ydjZ    Texpresso search in the literature
Synonym(s): ECK1750, G6947, b1752
Genome position(nucleotides): 1834808 --> 1835515 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.55
External database links:  
ASAP:
ABE-0005837
ECHOBASE:
EB3758
OU-MICROARRAY:
b1752
PortEco:
ydjZ
STRING:
511145.b1752
COLOMBOS: ydjZ


Product      
Name: DedA family protein YdjZ
Synonym(s): YdjZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 26.16
Isoelectric point: 10.54
Motif(s):
 
Type Positions Sequence
65 -> 85 VVSFLLMILQAIAAPLPAFLI
80 -> 197 LPAFLITFANASLFGAFWGGLLSWTSSMAGAALCFFIARVMGREVVEKLTGKTVLDSMDGFFTRYGKHTILVCRLLPFVPFDPISYAAGLTSIRFRSFFIATGLGQLPATIVYSWAGS
203 -> 223 TFWFVTGLFILFALTVVIFMA
96 -> 116 FWGGLLSWTSSMAGAALCFFI
177 -> 197 FFIATGLGQLPATIVYSWAGS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
[2] Serres MH., et al., 2001
External database links:  
ECOCYC:
G6947-MONOMER
ECOLIWIKI:
b1752
INTERPRO:
IPR015414
INTERPRO:
IPR032816
PANTHER:
PTHR12677
PFAM:
PF09335
PRIDE:
P76221
REFSEQ:
NP_416266
UNIPROT:
P76221


Operon      
Name: ydjXYZ-ynjABCD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2059 1834126 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2060 1834129 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2061 1835147 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2062 (cluster) 1835149 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Serres MH., Gopal S., Nahum LA., Liang P., Gaasterland T., Riley M., 2001, A functional update of the Escherichia coli K-12 genome., Genome Biol 2(9):RESEARCH0035

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB