RegulonDB RegulonDB 10.8: Gene Form
   

ynjA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ynjB ydjZ ydjY ynjA ynjC TSS_2062 (cluster) TSS_2062 (cluster) TSS_2061 TSS_2061 TSS_2060 TSS_2060 TSS_2059 TSS_2059

Gene      
Name: ynjA    Texpresso search in the literature
Synonym(s): ECK1751, G6948, b1753
Genome position(nucleotides): 1835515 --> 1836063 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.28
External database links:  
ASAP:
ABE-0005839
ECHOBASE:
EB3759
OU-MICROARRAY:
b1753
PortEco:
ynjA
STRING:
511145.b1753
COLOMBOS: ynjA


Product      
Name: AhpD-like domain-containing protein YnjA
Synonym(s): YnjA
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 20.533
Isoelectric point: 8.653
Motif(s):
 
Type Positions Sequence
52 -> 122 ERKRSPLDPVVRSLVSARIAQMCLCEFCVDITSMKVAERTGSSDKLLAVADWRQSPLFSDEERLALEYAEA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0051920 - peroxiredoxin activity
biological_process GO:0055114 - oxidation-reduction process
GO:0098869 - cellular oxidant detoxification
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6948-MONOMER
ECOLIWIKI:
b1753
INTERPRO:
IPR003779
INTERPRO:
IPR029032
MODBASE:
P76222
PFAM:
PF02627
PRIDE:
P76222
REFSEQ:
NP_416267
SMR:
P76222
UNIPROT:
P76222


Operon      
Name: ydjXYZ-ynjABCD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2059 1834126 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2060 1834129 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2061 1835147 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2062 (cluster) 1835149 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB