RegulonDB RegulonDB 10.6.3: Gene Form
   

ynjD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ynjC ynjE ynjB ynjD ynjEp ynjEp

Gene      
Name: ynjD    Texpresso search in the literature
Synonym(s): ECK1754, G6951, b1756
Genome position(nucleotides): 1838747 --> 1839400 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.07
External database links:  
ASAP:
ABE-0005845
ECHOBASE:
EB3762
ECOCYC:
G6951
ECOLIHUB:
ynjD
OU-MICROARRAY:
b1756
REGULONDB:
b1756
STRING:
511145.b1756
M3D: ynjD
COLOMBOS: ynjD
PortEco: b1756


Product      
Name: putative ABC transporter ATP-binding protein YnjD
Synonym(s): YnjD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 24.017
Isoelectric point: 5.817
Motif(s):
 
Type Positions Sequence
34 -> 41 GPSGCGKS
134 -> 137 LSGG
2 -> 216 LCVKNVSLRLPESRLLTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAEQFSCTGELWLNEQRIDILPTAQRQIGILFQDALLFDQFSVGQNLLLALPATLKGNARRNAVNDALERSGLEGAFHQDPATLSGGQRARVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEVRALAIPVVQVTHDLQDVPADSSVLDMAQWSENYNKL
17 -> 161 LTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAEQFSCTGELWLNEQRIDILPTAQRQIGILFQDALLFDQFSVGQNLLLALPATLKGNARRNAVNDALERSGLEGAFHQDPATLSGGQRARVALLRALLAQPKALLLDEPF
154 -> 160 ALLLDEP

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
GO:1990060 - maltose transport complex
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015423 - maltose-transporting ATPase activity
biological_process GO:0006810 - transport
GO:0015768 - maltose transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
YNJD-MONOMER
ECOLIWIKI:
b1756
INTERPRO:
IPR003593
INTERPRO:
IPR003439
INTERPRO:
IPR017871
INTERPRO:
IPR027417
MODBASE:
P76909
PFAM:
PF00005
PRIDE:
P76909
PROSITE:
PS50893
PROSITE:
PS00211
PROTEINMODELPORTAL:
P76909
REFSEQ:
NP_416270
SMART:
SM00382
SMR:
P76909
UNIPROT:
P76909


Operon      
Name: ydjXYZ-ynjABCD         
Operon arrangement:
Transcription unit        Promoter
null


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB