RegulonDB RegulonDB 10.7: Gene Form
   

ynjD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: ynjD    Texpresso search in the literature
Synonym(s): ECK1754, G6951, b1756
Genome position(nucleotides): 1838747 --> 1839400 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.07
External database links:  
ASAP:
ABE-0005845
ECHOBASE:
EB3762
OU-MICROARRAY:
b1756
PORTECO:
ynjD
REGULONDB:
b1756
STRING:
511145.b1756
M3D: ynjD
COLOMBOS: ynjD
PortEco: b1756


Product      
Name: putative ABC transporter ATP-binding protein YnjD
Synonym(s): YnjD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 24.017
Isoelectric point: 5.817
Motif(s):
 
Type Positions Sequence
34 -> 41 GPSGCGKS
134 -> 137 LSGG
2 -> 216 LCVKNVSLRLPESRLLTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAEQFSCTGELWLNEQRIDILPTAQRQIGILFQDALLFDQFSVGQNLLLALPATLKGNARRNAVNDALERSGLEGAFHQDPATLSGGQRARVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEVRALAIPVVQVTHDLQDVPADSSVLDMAQWSENYNKL
17 -> 161 LTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAEQFSCTGELWLNEQRIDILPTAQRQIGILFQDALLFDQFSVGQNLLLALPATLKGNARRNAVNDALERSGLEGAFHQDPATLSGGQRARVALLRALLAQPKALLLDEPF
154 -> 160 ALLLDEP

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0006810 - transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
YNJD-MONOMER
ECOLIWIKI:
b1756
INTERPRO:
IPR003593
INTERPRO:
IPR003439
INTERPRO:
IPR017871
INTERPRO:
IPR027417
MODBASE:
P76909
PFAM:
PF00005
PRIDE:
P76909
PROSITE:
PS50893
PROSITE:
PS00211
PROTEINMODELPORTAL:
P76909
REFSEQ:
NP_416270
SMART:
SM00382
SMR:
P76909
UNIPROT:
P76909


Operon      
Name: ydjXYZ-ynjABCD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB