RegulonDB RegulonDB 10.8: Gene Form
   

ynjF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ynjE ynjF nudG ynjH terminator ynjFp6 ynjFp6 nudGp3 nudGp3 ynjFp ynjFp

Gene      
Name: ynjF    Texpresso search in the literature
Synonym(s): ECK1756, G6953, b1758
Genome position(nucleotides): 1840783 <-- 1841403 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.46
External database links:  
ASAP:
ABE-0005850
ECHOBASE:
EB3764
OU-MICROARRAY:
b1758
PortEco:
ynjF
STRING:
511145.b1758
COLOMBOS: ynjF


Product      
Name: CDP-alcohol phosphatidyltransferase domain-containing protein YnjF
Synonym(s): YnjF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 22.752
Isoelectric point: 8.083
Motif(s):
 
Type Positions Sequence
80 -> 102 AGGFLDISLDFLFYALVPFGFIL
174 -> 196 FAWFAWIFGALCWMTTFTRVWSG
112 -> 134 GGWLLFAFIGTGSSFLAFAALAA
147 -> 169 SFYYLGGLTEGTETILLFVLGCL
27 -> 89 TPDGLTLVGFAIGVLALPFLALGWYLAALVVILLNRLLDGLDGALARRRELTDAGGFLDISLD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016780 - phosphotransferase activity, for other substituted phosphate groups
biological_process GO:0008654 - phospholipid biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6953-MONOMER
ECOLIWIKI:
b1758
INTERPRO:
IPR000462
PFAM:
PF01066
PRIDE:
P76226
PROSITE:
PS00379
REFSEQ:
NP_416272
SMR:
P76226
UNIPROT:
P76226


Operon      
Name: ynjF         
Operon arrangement:
Transcription unit        Promoter
ynjF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter nudGp3 1841438 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ynjFp6 1841611 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB