RegulonDB RegulonDB 10.8: Gene Form
   

ydjF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydjE ydjG ydjF terminator ydjFp1 ydjFp1 ydjFp7 ydjFp7 ydjEp6 ydjEp6 ydjEp5 ydjEp5

Gene      
Name: ydjF    Texpresso search in the literature
Synonym(s): ECK1768, G6957, b1770
Genome position(nucleotides): 1854096 <-- 1854854 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.29
External database links:  
ASAP:
ABE-0005897
ECHOBASE:
EB3255
OU-MICROARRAY:
b1770
PortEco:
ydjF
STRING:
511145.b1770
COLOMBOS: ydjF


Product      
Name: putative DNA-binding transcriptional regulator YdjF
Synonym(s): YdjF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.261
Isoelectric point: 7.059
Motif(s):
 
Type Positions Sequence
3 -> 58 AKDRIQAIKQMVANDKKVTVSNLSGIFQVTEETIRRDLEKLEDEGFLTRTYGGAVL
6 -> 60 RIQAIKQMVANDKKVTVSNLSGIFQVTEETIRRDLEKLEDEGFLTRTYGGAVLNT
20 -> 39 VTVSNLSGIFQVTEETIRRD
77 -> 233 YEEKQLIARKALPFIDNKTTMAADSSSTVMELLKLLQDRSGLTLLTNSAEAIHVLAQSEIKVVSTGGELNKNTLSLQGRITKEIIRRYHVDIMVMSCKGLDINSGALDSNEAEAEIKKTMIRQATEVALLVDHSKFDRKAFVQLADFSHINYIITDK

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
Reference(s): [1] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-11769N
ECOCYC:
G6957-MONOMER
ECOLIWIKI:
b1770
INTERPRO:
IPR014036
INTERPRO:
IPR037171
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR018356
INTERPRO:
IPR001034
MODBASE:
P77721
PFAM:
PF00455
PFAM:
PF08220
PRIDE:
P77721
PRINTS:
PR00037
PROSITE:
PS51000
PROSITE:
PS00894
REFSEQ:
NP_416284
SMART:
SM00420
SMR:
P77721
UNIPROT:
P77721


Operon      
Name: ydjF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydjEp5 1853983 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ydjEp6 1854041 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ydjFp7 1854886 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ydjFp1 1854924 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB