RegulonDB RegulonDB 10.8: Gene Form
   

ydjL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydjK ydjL yeaC TSS_2078 TSS_2078

Gene      
Name: ydjL    Texpresso search in the literature
Synonym(s): ECK1774, G6963, b1776
Genome position(nucleotides): 1860256 <-- 1861332 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.77
External database links:  
ASAP:
ABE-0005912
ECHOBASE:
EB3261
OU-MICROARRAY:
b1776
PortEco:
ydjL
STRING:
511145.b1776
COLOMBOS: ydjL


Product      
Name: putative zinc-binding dehydrogenase YdjL
Synonym(s): YdjL, putative oxidoreductase, Zn-dependent and NAD(P)-binding
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 38.732
Isoelectric point: 5.664
Motif(s):
 
Type Positions Sequence
185 -> 316 PLGLFSVQMARIMGAVNIVVVGLQEDVAVRFPVAKELGATAVVNGSTEDVVARCQQICGKDNLGLVIECSGANIALKQAIEMLRPNGEVVRVGMGFKPLDFSINDITAWNKSIIGHMAYDSTSWRNAIRLLA
27 -> 132 EDVVIEIKAAAICGADMKHYNVDSGSDEFNSIRGHEFAGCIAQVGEKVKDWKVGQRVVSDNSGHVCGVCPACEQGDFLCCTEKVNLGLDNNTWGGGFSKYCLVPGE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0008270 - zinc ion binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11774N
ECOCYC:
G6963-MONOMER
ECOLIWIKI:
b1776
INTERPRO:
IPR013149
INTERPRO:
IPR036291
INTERPRO:
IPR013154
INTERPRO:
IPR011032
INTERPRO:
IPR002328
MODBASE:
P77539
PANTHER:
PTHR11695
PFAM:
PF00107
PFAM:
PF08240
PRIDE:
P77539
PROSITE:
PS00059
REFSEQ:
NP_416290
SMR:
P77539
UNIPROT:
P77539


Operon      
Name: ydjLKJIHG         
Operon arrangement:
Transcription unit        Promoter
ydjLKJIHG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2078 1861527 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB