RegulonDB RegulonDB 10.8: Gene Form
   

mipA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeaG yeaE mipA PhoB NsrR anti-anti-terminator anti-terminator terminator yeaGp1 yeaGp1 yeaGp2 yeaGp2 mipAp mipAp yeaEp yeaEp TSS_2121 TSS_2121

Gene      
Name: mipA    Texpresso search in the literature
Synonym(s): ECK1780, G6968, b1782, yeaF
Genome position(nucleotides): 1865726 <-- 1866472 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.21
External database links:  
ASAP:
ABE-0005928
ECHOBASE:
EB3265
OU-MICROARRAY:
b1782
PortEco:
mipA
STRING:
511145.b1782
COLOMBOS: mipA


Product      
Name: MltA-interacting protein
Synonym(s): MipA, YeaF, scaffolding protein that interacts with murein polymerase and murein hydrolase
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 27.831
Isoelectric point: 5.614
Motif(s):
 
Type Positions Sequence
28 -> 248 LGAGVGVVEHPYKDYDTDVYPVPVINYEGDNFWFRGLGGGYYLWNDATDKLSITAYWSPLYFKAKDSGDHQMRHLDDRKSTMMAGLSYAHFTQYGYLRTTLAGDTLDNSNGIVWDMAWLYRYTNGGLTVTPGIGVQWNSENQNEYYYGVSRKESARSGLRGYNPNDSWSPYLELSASYNFLGDWSVYGTARYTRLSDEVTDSPMVDKSWTGLISTGITYKF
1 -> 22 MTKLKLLALGVLIATSAGVAHA
34 -> 34 V
23 -> 248 EGKFSLGAGVGVVEHPYKDYDTDVYPVPVINYEGDNFWFRGLGGGYYLWNDATDKLSITAYWSPLYFKAKDSGDHQMRHLDDRKSTMMAGLSYAHFTQYGYLRTTLAGDTLDNSNGIVWDMAWLYRYTNGGLTVTPGIGVQWNSENQNEYYYGVSRKESARSGLRGYNPNDSWSPYLELSASYNFLGDWSVYGTARYTRLSDEVTDSPMVDKSWTGLISTGITYKF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  6 - cell structure --> 6.2 - murein
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
molecular_function GO:0030674 - protein-macromolecule adaptor activity
biological_process GO:0009252 - peptidoglycan biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [IPI] Inferred from physical interaction
Reference(s): [1] Ben-Shem A., et al., 2007
[2] Elad T., et al., 2008
[3] Han MJ., et al., 2006
[4] Legaree BA., et al., 2007
[5] Li H., et al., 2015
[6] Meisel U., et al., 2003
[7] Vollmer W., et al., 1999
External database links:  
ECOCYC:
G6968-MONOMER
ECOLIWIKI:
b1782
INTERPRO:
IPR010583
PANTHER:
PTHR38776
PFAM:
PF06629
PRIDE:
P0A908
PRODB:
PRO_000023241
REFSEQ:
NP_416296
SMR:
P0A908
UNIPROT:
P0A908


Operon      
Name: mipA         
Operon arrangement:
Transcription unit        Promoter
mipA


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2121 1865653 reverse nd [RS-EPT-CBR] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Ben-Shem A., Fass D., Bibi E., 2007, Structural basis for intramembrane proteolysis by rhomboid serine proteases., Proc Natl Acad Sci U S A 104(2):462-6

 [2] Elad T., Benovich E., Magrisso S., Belkin S., 2008, Toxicant identification by a luminescent bacterial bioreporter panel: application of pattern classification algorithms., Environ Sci Technol 42(22):8486-91

 [3] Han MJ., Lee SY., 2006, The Escherichia coli proteome: past, present, and future prospects., Microbiol Mol Biol Rev 70(2):362-439

 [4] Legaree BA., Adams CB., Clarke AJ., 2007, Overproduction of penicillin-binding protein 2 and its inactive variants causes morphological changes and lysis in Escherichia coli., J Bacteriol 189(14):4975-83

 [5] Li H., Zhang DF., Lin XM., Peng XX., 2015, Outer membrane proteomics of kanamycin-resistant Escherichia coli identified MipA as a novel antibiotic resistance-related protein., FEMS Microbiol Lett 362(11)

 [6] Meisel U., Holtje JV., Vollmer W., 2003, Overproduction of inactive variants of the murein synthase PBP1B causes lysis in Escherichia coli., J Bacteriol 185(18):5342-8

 [7] Vollmer W., von Rechenberg M., Holtje JV., 1999, Demonstration of molecular interactions between the murein polymerase PBP1B, the lytic transglycosylase MltA, and the scaffolding protein MipA of Escherichia coli., J Biol Chem 274(10):6726-34

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB