RegulonDB RegulonDB 10.8: Gene Form
   

dgcJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcJ cdgI yeaK TSS_2123 TSS_2123 yeaJp6 yeaJp6

Gene      
Name: dgcJ    Texpresso search in the literature
Synonym(s): ECK1784, G6972, b1786, yeaJ
Genome position(nucleotides): 1872041 --> 1873531 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.01
External database links:  
ASAP:
ABE-0005943
ECHOBASE:
EB3269
OU-MICROARRAY:
b1786
PortEco:
yeaJ
STRING:
511145.b1786
COLOMBOS: dgcJ


Product      
Name: putative diguanylate cyclase DgcJ
Synonym(s): DgcJ, YeaJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 56.603
Isoelectric point: 6.898
Motif(s):
 
Type Positions Sequence
346 -> 494 SDAMTGLYNRKILTPELEQRLQKLVQSGSSVMFIAIDMDKLKQINDTLGHQEGDLAITLLAQAIKQSIRKSDYAIRLGGDEFCIILVDSTPQIAAQLPERIEKRLQHIAPQKEIGFSSGIYAMKENDTLHDAYKASDERLYVNKQNKNS
31 -> 304 SDRAMSAYLRYIVQKADSSFLYDKYQNQSIAAHVMRALAAEQSEVSPEQRRAICEAFESANNTHGLNLTAHKYPGLRGTLQTASTDCDTIVEAAALLPAFDQAVEGNRHQDDYGSGLGMAEEKFHYYLDLNDRYVYFYEPVNVEYFAMNNWSFLQSGSIGIDRKDIEKVFTGRTVLSSIYQDQRTKQNVMSLLTPVYVAGQLKGIVLLDINKNNLRNIFYTHDRPLLWRFLNVTLTDTDSGRDIIINQSEDNLFQYVSYVHDLPGGIRVSLSID
305 -> 325 ILYFITSSWKSVLFWILTALI
374 -> 496 SSVMFIAIDMDKLKQINDTLGHQEGDLAITLLAQAIKQSIRKSDYAIRLGGDEFCIILVDSTPQIAAQLPERIEKRLQHIAPQKEIGFSSGIYAMKENDTLHDAYKASDERLYVNKQNKNSRS
11 -> 31 FIAASVIVLTSSFLIFELVAS

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
GO:0052621 - diguanylate cyclase activity
biological_process GO:0043709 - cell adhesion involved in single-species biofilm formation
GO:1902201 - negative regulation of bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
Reference(s): [1] Sanchez-Torres V., et al., 2011
External database links:  
DIP:
DIP-11789N
ECOCYC:
G6972-MONOMER
ECOLIWIKI:
b1786
INTERPRO:
IPR029787
INTERPRO:
IPR033420
INTERPRO:
IPR000160
MINT:
MINT-1239476
PFAM:
PF17155
PFAM:
PF00990
PRIDE:
P76237
PROSITE:
PS50887
REFSEQ:
NP_416300
SMART:
SM00267
SMR:
P76237
UNIPROT:
P76237


Operon      
Name: dgcJ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yeaJp6 1871937 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2123 1873544 forward nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sanchez-Torres V., Hu H., Wood TK., 2011, GGDEF proteins YeaI, YedQ, and YfiN reduce early biofilm formation and swimming motility in Escherichia coli., Appl Microbiol Biotechnol 90(2):651-8

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB